Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QFV0

Protein Details
Accession S7QFV0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-72AAAAAKPVQPAKKRKREEKDEAPAPRRQHydrophilic
NLS Segment(s)
PositionSequence
40-109AQAKRAAAAAKPVQPAKKRKREEKDEAPAPRRQSTRLRRAGAADPNETPAERKIREKLEEERRMKEEEER
112-121AEEKAREARK
Subcellular Location(s) nucl 15, cyto 8.5, cyto_mito 6.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006974  P:DNA damage response  
KEGG gtr:GLOTRDRAFT_114563  -  
PROSITE View protein in PROSITE  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MPKTAYELEREANIAKNRAILEELDLKGAVAQLGLPSKGAQAKRAAAAAKPVQPAKKRKREEKDEAPAPRRQSTRLRRAGAADPNETPAERKIREKLEEERRMKEEEERLEAEEKAREARKPRHQDLDLETLMEGEQPEDVAALKSTLAEVCKTSHAKRTAEQDAFVFDDDEKEEVGLAALRKRMQKLKVVARAKVTQDRVYSAVYHPEVSKDIILFGDKHGQLGLWDARAAPDEVAGEDEEVSATANGEDGKYWRMQAHWPVTSKSSISTVKLDPIDSNNVFTSAYDCTIRKLDLTTGVSREIHSTEDVLISSIDLPPAGHEMWISDALGGISHLDLREHPSKARWYGLSDQKIGCVSINPVNPQYLLTASNSRALRLWDARKLQTFSGVAEGALLTPPPSSPVPASRIRGATTDDRAGPEEHGAEEVEQFLKSKRGKGCLRAEWVHGKSVSSAYWDPRGRSIVSTSYDDTLRLWDIRPAAFDKGTTLPSFRPFSQIRHNCQTGKWLTILKAQWTPNPDVYPHFTIGNMDHSLDIFSCKGDVVAKLSDRQRISAVQAVTCSHPSIVERAASGNASGRCVLWALPDDSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.32
4 0.31
5 0.3
6 0.3
7 0.23
8 0.23
9 0.28
10 0.27
11 0.25
12 0.24
13 0.22
14 0.21
15 0.21
16 0.15
17 0.08
18 0.07
19 0.09
20 0.12
21 0.12
22 0.12
23 0.12
24 0.16
25 0.23
26 0.23
27 0.25
28 0.28
29 0.31
30 0.33
31 0.37
32 0.34
33 0.29
34 0.36
35 0.38
36 0.38
37 0.4
38 0.43
39 0.47
40 0.54
41 0.64
42 0.67
43 0.71
44 0.75
45 0.8
46 0.86
47 0.88
48 0.9
49 0.9
50 0.89
51 0.87
52 0.87
53 0.82
54 0.76
55 0.71
56 0.68
57 0.6
58 0.55
59 0.57
60 0.58
61 0.64
62 0.68
63 0.67
64 0.63
65 0.65
66 0.67
67 0.65
68 0.59
69 0.52
70 0.43
71 0.42
72 0.4
73 0.36
74 0.3
75 0.27
76 0.3
77 0.29
78 0.33
79 0.37
80 0.43
81 0.48
82 0.51
83 0.55
84 0.58
85 0.67
86 0.65
87 0.64
88 0.6
89 0.58
90 0.54
91 0.52
92 0.48
93 0.42
94 0.43
95 0.39
96 0.39
97 0.38
98 0.37
99 0.32
100 0.28
101 0.24
102 0.24
103 0.26
104 0.28
105 0.34
106 0.43
107 0.51
108 0.59
109 0.64
110 0.67
111 0.66
112 0.67
113 0.65
114 0.63
115 0.53
116 0.44
117 0.37
118 0.28
119 0.25
120 0.2
121 0.14
122 0.06
123 0.06
124 0.05
125 0.05
126 0.05
127 0.06
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.08
135 0.08
136 0.09
137 0.09
138 0.11
139 0.17
140 0.21
141 0.23
142 0.3
143 0.35
144 0.37
145 0.4
146 0.45
147 0.48
148 0.45
149 0.44
150 0.36
151 0.32
152 0.31
153 0.27
154 0.2
155 0.11
156 0.11
157 0.11
158 0.11
159 0.09
160 0.08
161 0.07
162 0.06
163 0.07
164 0.07
165 0.08
166 0.1
167 0.13
168 0.16
169 0.19
170 0.24
171 0.3
172 0.32
173 0.38
174 0.44
175 0.51
176 0.57
177 0.58
178 0.57
179 0.56
180 0.57
181 0.54
182 0.53
183 0.47
184 0.41
185 0.38
186 0.37
187 0.34
188 0.3
189 0.27
190 0.21
191 0.23
192 0.2
193 0.2
194 0.18
195 0.17
196 0.17
197 0.17
198 0.16
199 0.1
200 0.1
201 0.09
202 0.1
203 0.09
204 0.1
205 0.16
206 0.15
207 0.15
208 0.15
209 0.14
210 0.13
211 0.17
212 0.16
213 0.09
214 0.09
215 0.09
216 0.1
217 0.11
218 0.12
219 0.07
220 0.07
221 0.07
222 0.06
223 0.08
224 0.07
225 0.06
226 0.06
227 0.06
228 0.05
229 0.05
230 0.05
231 0.04
232 0.04
233 0.03
234 0.04
235 0.04
236 0.04
237 0.05
238 0.05
239 0.07
240 0.08
241 0.09
242 0.09
243 0.1
244 0.13
245 0.2
246 0.24
247 0.27
248 0.28
249 0.28
250 0.3
251 0.29
252 0.26
253 0.2
254 0.19
255 0.17
256 0.17
257 0.19
258 0.17
259 0.2
260 0.21
261 0.2
262 0.17
263 0.17
264 0.21
265 0.18
266 0.19
267 0.15
268 0.15
269 0.14
270 0.14
271 0.13
272 0.08
273 0.09
274 0.09
275 0.09
276 0.1
277 0.11
278 0.12
279 0.1
280 0.1
281 0.1
282 0.13
283 0.16
284 0.16
285 0.16
286 0.17
287 0.17
288 0.17
289 0.17
290 0.13
291 0.11
292 0.1
293 0.09
294 0.08
295 0.08
296 0.08
297 0.07
298 0.06
299 0.05
300 0.06
301 0.05
302 0.05
303 0.04
304 0.04
305 0.04
306 0.06
307 0.06
308 0.06
309 0.05
310 0.06
311 0.07
312 0.08
313 0.07
314 0.05
315 0.05
316 0.05
317 0.05
318 0.05
319 0.04
320 0.03
321 0.04
322 0.04
323 0.04
324 0.05
325 0.1
326 0.15
327 0.16
328 0.17
329 0.2
330 0.24
331 0.26
332 0.28
333 0.24
334 0.24
335 0.3
336 0.38
337 0.38
338 0.36
339 0.34
340 0.33
341 0.32
342 0.28
343 0.21
344 0.14
345 0.13
346 0.15
347 0.17
348 0.18
349 0.18
350 0.18
351 0.18
352 0.18
353 0.16
354 0.12
355 0.11
356 0.11
357 0.14
358 0.14
359 0.2
360 0.2
361 0.19
362 0.19
363 0.19
364 0.22
365 0.25
366 0.28
367 0.29
368 0.33
369 0.36
370 0.4
371 0.4
372 0.36
373 0.34
374 0.31
375 0.25
376 0.23
377 0.2
378 0.15
379 0.13
380 0.13
381 0.08
382 0.08
383 0.07
384 0.04
385 0.04
386 0.04
387 0.07
388 0.08
389 0.09
390 0.11
391 0.15
392 0.2
393 0.25
394 0.28
395 0.29
396 0.31
397 0.3
398 0.3
399 0.3
400 0.3
401 0.28
402 0.28
403 0.25
404 0.25
405 0.26
406 0.25
407 0.22
408 0.18
409 0.16
410 0.13
411 0.12
412 0.11
413 0.1
414 0.09
415 0.09
416 0.09
417 0.08
418 0.09
419 0.09
420 0.16
421 0.18
422 0.25
423 0.28
424 0.36
425 0.41
426 0.5
427 0.58
428 0.57
429 0.63
430 0.58
431 0.59
432 0.59
433 0.55
434 0.5
435 0.42
436 0.35
437 0.29
438 0.28
439 0.24
440 0.2
441 0.21
442 0.19
443 0.27
444 0.3
445 0.29
446 0.32
447 0.34
448 0.31
449 0.3
450 0.3
451 0.27
452 0.28
453 0.3
454 0.28
455 0.27
456 0.26
457 0.25
458 0.22
459 0.19
460 0.18
461 0.16
462 0.15
463 0.16
464 0.18
465 0.19
466 0.21
467 0.21
468 0.23
469 0.22
470 0.21
471 0.21
472 0.22
473 0.24
474 0.22
475 0.21
476 0.21
477 0.26
478 0.3
479 0.28
480 0.32
481 0.32
482 0.36
483 0.45
484 0.51
485 0.53
486 0.58
487 0.62
488 0.57
489 0.55
490 0.59
491 0.51
492 0.45
493 0.4
494 0.35
495 0.32
496 0.37
497 0.39
498 0.34
499 0.38
500 0.37
501 0.38
502 0.4
503 0.43
504 0.41
505 0.4
506 0.37
507 0.35
508 0.39
509 0.39
510 0.36
511 0.31
512 0.26
513 0.26
514 0.27
515 0.27
516 0.22
517 0.18
518 0.17
519 0.17
520 0.17
521 0.15
522 0.16
523 0.11
524 0.1
525 0.1
526 0.1
527 0.1
528 0.12
529 0.13
530 0.15
531 0.2
532 0.22
533 0.28
534 0.33
535 0.39
536 0.38
537 0.38
538 0.37
539 0.35
540 0.37
541 0.37
542 0.34
543 0.29
544 0.29
545 0.3
546 0.3
547 0.29
548 0.25
549 0.19
550 0.19
551 0.19
552 0.21
553 0.22
554 0.2
555 0.19
556 0.2
557 0.21
558 0.2
559 0.19
560 0.22
561 0.2
562 0.21
563 0.21
564 0.19
565 0.18
566 0.18
567 0.18
568 0.16
569 0.19