Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7Q7C1

Protein Details
Accession S7Q7C1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
174-193LPGPRPPRPDDPTPRKPPKCBasic
NLS Segment(s)
PositionSequence
205-240KRRKERGEDEAVRRAREIMLRGPKAGPSKLPPSKPG
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_111211  -  
Amino Acid Sequences MVFRMESGEGPFAQPSSSDTPAPSNPWTYRLLYRGGLSLPDSHLTLDGLAFLLRRPASLEKMELDNPLALALETLRGRPTLRFLGTAKVKDLWLDEGPSGDVLMYIHPDSFLTTVYFENILCLQPELSDDGRTEDGVRIGLGDDHSEILVYGQRQQMPTSSPSSLLTLCVSRILPGPRPPRPDDPTPRKPPKCLLLSEADGGQNKRRKERGEDEAVRRAREIMLRGPKAGPSKLPPSKPGPNNAKSSDATFKVPNVPAGSRAAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.19
4 0.21
5 0.21
6 0.21
7 0.26
8 0.29
9 0.33
10 0.31
11 0.31
12 0.3
13 0.32
14 0.35
15 0.33
16 0.35
17 0.34
18 0.35
19 0.3
20 0.3
21 0.29
22 0.26
23 0.24
24 0.21
25 0.2
26 0.19
27 0.18
28 0.17
29 0.15
30 0.15
31 0.13
32 0.12
33 0.1
34 0.08
35 0.07
36 0.07
37 0.06
38 0.06
39 0.11
40 0.1
41 0.1
42 0.14
43 0.17
44 0.21
45 0.23
46 0.25
47 0.22
48 0.26
49 0.27
50 0.24
51 0.22
52 0.18
53 0.16
54 0.14
55 0.12
56 0.08
57 0.07
58 0.06
59 0.08
60 0.08
61 0.09
62 0.1
63 0.1
64 0.12
65 0.12
66 0.17
67 0.18
68 0.19
69 0.22
70 0.22
71 0.29
72 0.33
73 0.34
74 0.31
75 0.27
76 0.26
77 0.23
78 0.23
79 0.19
80 0.15
81 0.15
82 0.13
83 0.12
84 0.12
85 0.12
86 0.1
87 0.06
88 0.06
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.06
97 0.06
98 0.07
99 0.06
100 0.07
101 0.07
102 0.08
103 0.08
104 0.07
105 0.08
106 0.08
107 0.08
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.08
114 0.08
115 0.09
116 0.09
117 0.11
118 0.11
119 0.11
120 0.11
121 0.09
122 0.08
123 0.08
124 0.07
125 0.05
126 0.05
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.04
136 0.06
137 0.06
138 0.09
139 0.11
140 0.13
141 0.14
142 0.15
143 0.16
144 0.16
145 0.19
146 0.19
147 0.17
148 0.16
149 0.16
150 0.18
151 0.16
152 0.15
153 0.13
154 0.11
155 0.1
156 0.11
157 0.1
158 0.09
159 0.13
160 0.15
161 0.19
162 0.27
163 0.34
164 0.38
165 0.44
166 0.48
167 0.53
168 0.55
169 0.6
170 0.63
171 0.65
172 0.7
173 0.75
174 0.81
175 0.76
176 0.74
177 0.71
178 0.68
179 0.63
180 0.55
181 0.49
182 0.44
183 0.43
184 0.4
185 0.36
186 0.3
187 0.27
188 0.27
189 0.3
190 0.3
191 0.31
192 0.37
193 0.42
194 0.44
195 0.5
196 0.56
197 0.57
198 0.63
199 0.68
200 0.67
201 0.7
202 0.68
203 0.6
204 0.53
205 0.45
206 0.37
207 0.32
208 0.29
209 0.29
210 0.36
211 0.37
212 0.39
213 0.39
214 0.41
215 0.42
216 0.41
217 0.36
218 0.32
219 0.41
220 0.47
221 0.5
222 0.51
223 0.54
224 0.61
225 0.62
226 0.66
227 0.66
228 0.64
229 0.68
230 0.66
231 0.63
232 0.55
233 0.54
234 0.52
235 0.44
236 0.42
237 0.37
238 0.36
239 0.38
240 0.38
241 0.38
242 0.35
243 0.33
244 0.32
245 0.34