Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7R7G0

Protein Details
Accession S7R7G0    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-43DKFLPNKEKKTTRRKTTQPTKKQLKAHEHydrophilic
NLS Segment(s)
PositionSequence
22-50KEKKTTRRKTTQPTKKQLKAHEKAERDKK
Subcellular Location(s) nucl 23, cyto 2.5, cyto_pero 2
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_134055  -  
Amino Acid Sequences MDNDEEEEEDESEMEDKFLPNKEKKTTRRKTTQPTKKQLKAHEKAERDKKADEDRADAEAIRHNIFNIVPPTGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.1
5 0.16
6 0.23
7 0.27
8 0.33
9 0.41
10 0.5
11 0.59
12 0.67
13 0.72
14 0.74
15 0.78
16 0.81
17 0.83
18 0.85
19 0.86
20 0.85
21 0.86
22 0.86
23 0.83
24 0.8
25 0.79
26 0.78
27 0.73
28 0.72
29 0.7
30 0.66
31 0.67
32 0.72
33 0.68
34 0.61
35 0.56
36 0.53
37 0.53
38 0.55
39 0.48
40 0.43
41 0.39
42 0.37
43 0.36
44 0.31
45 0.24
46 0.23
47 0.24
48 0.21
49 0.19
50 0.17
51 0.19
52 0.19
53 0.23
54 0.2