Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QJV7

Protein Details
Accession S7QJV7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
218-243DALTWARRRRDARKENRRRDEPMTCSHydrophilic
NLS Segment(s)
PositionSequence
224-235RRRRDARKENRR
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_109716  -  
Amino Acid Sequences MSSASARCYSPVPSPMSSPEFLPTPLPSPRPVIRKSSSSSLRRLQLEPAVDPPIPPRLIGSPLLQRTLPSRQTRRDDLSRKDKSPMLAKGFVDGYEFGVGAPPAAEYSARRSPRRRPAPLPLSAPATPSSFAYPSPRKQLHRRSPSVAFPVSPRSPPLTPVISSPPPPVPPIPAFLLEPGDIVSKPVLRPLRGNGIEECKPEHVAIPDLDLEMEMGEDALTWARRRRDARKENRRRDEPMTCSRFLSLSNGRRTVGNAMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.41
4 0.39
5 0.34
6 0.3
7 0.27
8 0.26
9 0.26
10 0.22
11 0.22
12 0.26
13 0.27
14 0.27
15 0.32
16 0.37
17 0.42
18 0.44
19 0.47
20 0.47
21 0.5
22 0.53
23 0.56
24 0.59
25 0.56
26 0.6
27 0.59
28 0.6
29 0.59
30 0.55
31 0.49
32 0.45
33 0.43
34 0.37
35 0.33
36 0.31
37 0.27
38 0.26
39 0.23
40 0.25
41 0.22
42 0.2
43 0.19
44 0.17
45 0.21
46 0.22
47 0.24
48 0.25
49 0.27
50 0.29
51 0.27
52 0.25
53 0.27
54 0.32
55 0.36
56 0.38
57 0.43
58 0.49
59 0.56
60 0.61
61 0.64
62 0.66
63 0.67
64 0.67
65 0.7
66 0.69
67 0.65
68 0.62
69 0.58
70 0.52
71 0.51
72 0.49
73 0.44
74 0.41
75 0.39
76 0.38
77 0.36
78 0.32
79 0.25
80 0.19
81 0.14
82 0.1
83 0.1
84 0.07
85 0.08
86 0.07
87 0.06
88 0.06
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.11
95 0.19
96 0.23
97 0.28
98 0.33
99 0.42
100 0.52
101 0.61
102 0.62
103 0.6
104 0.65
105 0.67
106 0.68
107 0.62
108 0.53
109 0.48
110 0.41
111 0.37
112 0.28
113 0.22
114 0.17
115 0.14
116 0.14
117 0.1
118 0.11
119 0.16
120 0.2
121 0.21
122 0.29
123 0.34
124 0.37
125 0.46
126 0.56
127 0.6
128 0.65
129 0.66
130 0.63
131 0.62
132 0.61
133 0.57
134 0.47
135 0.37
136 0.29
137 0.31
138 0.28
139 0.25
140 0.22
141 0.22
142 0.21
143 0.23
144 0.25
145 0.21
146 0.2
147 0.21
148 0.26
149 0.24
150 0.25
151 0.26
152 0.24
153 0.23
154 0.24
155 0.23
156 0.21
157 0.2
158 0.22
159 0.21
160 0.2
161 0.19
162 0.18
163 0.19
164 0.14
165 0.13
166 0.11
167 0.1
168 0.09
169 0.09
170 0.1
171 0.1
172 0.1
173 0.17
174 0.19
175 0.19
176 0.22
177 0.25
178 0.35
179 0.34
180 0.37
181 0.33
182 0.36
183 0.38
184 0.36
185 0.35
186 0.27
187 0.26
188 0.24
189 0.24
190 0.19
191 0.19
192 0.18
193 0.18
194 0.17
195 0.15
196 0.15
197 0.12
198 0.1
199 0.07
200 0.07
201 0.04
202 0.04
203 0.03
204 0.03
205 0.04
206 0.06
207 0.08
208 0.11
209 0.17
210 0.21
211 0.29
212 0.37
213 0.46
214 0.55
215 0.64
216 0.74
217 0.79
218 0.86
219 0.9
220 0.94
221 0.91
222 0.86
223 0.83
224 0.81
225 0.78
226 0.77
227 0.73
228 0.63
229 0.58
230 0.52
231 0.45
232 0.36
233 0.37
234 0.36
235 0.38
236 0.44
237 0.46
238 0.45
239 0.46
240 0.47