Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q406

Protein Details
Accession S7Q406    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
306-328DAESSPHRPKKKAKAKAVVQESSHydrophilic
NLS Segment(s)
PositionSequence
312-321HRPKKKAKAK
338-367RRKRLSKIVSGEASRRGGARQPLKRGGKRF
Subcellular Location(s) nucl 17.5, cyto_nucl 14.5, cyto 8.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_122033  -  
Amino Acid Sequences MSGLKVSRLPYIWRDSNPDTEPPYGDQDDELAWRVHNTNRLSGLHTPAHFADMTLVISESLNADLAMELECEHFKWKWEAYSLGPRISLELLSKHLIMPLISTVHLAFASADPVSELSQEDLQNLVDKAGKTARRTVDTHVKHALSNPRTATTLRRMTALFNFVPSLPPITLSLEKLDISRPFQSKGGSTSKDVKGITEGGELRYAHSTTPAESAEKTVLASQGPGGDSGSETEPESEEEFARVLRLAREKAAAGSAKSTATSIAERGSPVQGSSRQSKPAPSASAPQQTGSRAKTTSGESPSSSDAESSPHRPKKKAKAKAVVQESSSDAENSEEERRKRLSKIVSGEASRRGGARQPLKRGGKRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.54
4 0.53
5 0.52
6 0.47
7 0.44
8 0.43
9 0.38
10 0.4
11 0.34
12 0.31
13 0.26
14 0.23
15 0.21
16 0.21
17 0.2
18 0.14
19 0.13
20 0.15
21 0.18
22 0.2
23 0.26
24 0.27
25 0.3
26 0.34
27 0.35
28 0.37
29 0.39
30 0.41
31 0.39
32 0.37
33 0.35
34 0.31
35 0.32
36 0.27
37 0.23
38 0.19
39 0.14
40 0.14
41 0.11
42 0.11
43 0.09
44 0.09
45 0.09
46 0.08
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.08
58 0.08
59 0.11
60 0.11
61 0.14
62 0.18
63 0.2
64 0.22
65 0.24
66 0.26
67 0.28
68 0.38
69 0.38
70 0.35
71 0.33
72 0.3
73 0.29
74 0.27
75 0.23
76 0.14
77 0.13
78 0.15
79 0.16
80 0.16
81 0.15
82 0.15
83 0.15
84 0.13
85 0.12
86 0.11
87 0.1
88 0.1
89 0.1
90 0.09
91 0.09
92 0.09
93 0.08
94 0.07
95 0.06
96 0.07
97 0.07
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.11
106 0.11
107 0.11
108 0.11
109 0.11
110 0.13
111 0.12
112 0.12
113 0.11
114 0.11
115 0.13
116 0.18
117 0.22
118 0.21
119 0.28
120 0.31
121 0.32
122 0.34
123 0.38
124 0.42
125 0.41
126 0.44
127 0.42
128 0.39
129 0.35
130 0.38
131 0.42
132 0.33
133 0.35
134 0.32
135 0.28
136 0.28
137 0.29
138 0.28
139 0.27
140 0.31
141 0.27
142 0.28
143 0.27
144 0.28
145 0.29
146 0.29
147 0.21
148 0.16
149 0.16
150 0.14
151 0.15
152 0.13
153 0.13
154 0.08
155 0.09
156 0.09
157 0.11
158 0.12
159 0.12
160 0.13
161 0.12
162 0.12
163 0.12
164 0.14
165 0.12
166 0.14
167 0.18
168 0.18
169 0.19
170 0.2
171 0.2
172 0.19
173 0.23
174 0.26
175 0.22
176 0.24
177 0.3
178 0.29
179 0.32
180 0.31
181 0.26
182 0.22
183 0.21
184 0.2
185 0.16
186 0.15
187 0.12
188 0.15
189 0.15
190 0.14
191 0.15
192 0.15
193 0.11
194 0.13
195 0.13
196 0.11
197 0.13
198 0.13
199 0.12
200 0.12
201 0.13
202 0.11
203 0.11
204 0.1
205 0.09
206 0.09
207 0.08
208 0.08
209 0.07
210 0.08
211 0.08
212 0.08
213 0.07
214 0.06
215 0.07
216 0.08
217 0.08
218 0.08
219 0.08
220 0.08
221 0.08
222 0.1
223 0.11
224 0.1
225 0.09
226 0.09
227 0.09
228 0.09
229 0.09
230 0.08
231 0.08
232 0.11
233 0.15
234 0.16
235 0.17
236 0.19
237 0.19
238 0.19
239 0.22
240 0.2
241 0.15
242 0.16
243 0.16
244 0.14
245 0.14
246 0.14
247 0.1
248 0.1
249 0.11
250 0.1
251 0.1
252 0.11
253 0.11
254 0.12
255 0.14
256 0.12
257 0.12
258 0.15
259 0.18
260 0.22
261 0.27
262 0.29
263 0.33
264 0.34
265 0.37
266 0.38
267 0.39
268 0.39
269 0.36
270 0.39
271 0.4
272 0.47
273 0.44
274 0.41
275 0.38
276 0.37
277 0.4
278 0.36
279 0.33
280 0.26
281 0.26
282 0.28
283 0.29
284 0.33
285 0.32
286 0.32
287 0.29
288 0.31
289 0.32
290 0.31
291 0.27
292 0.2
293 0.16
294 0.18
295 0.21
296 0.25
297 0.33
298 0.4
299 0.46
300 0.52
301 0.62
302 0.69
303 0.75
304 0.79
305 0.79
306 0.81
307 0.85
308 0.87
309 0.86
310 0.79
311 0.69
312 0.61
313 0.52
314 0.44
315 0.36
316 0.26
317 0.18
318 0.15
319 0.15
320 0.16
321 0.23
322 0.29
323 0.29
324 0.35
325 0.4
326 0.43
327 0.46
328 0.51
329 0.51
330 0.52
331 0.58
332 0.61
333 0.62
334 0.61
335 0.62
336 0.6
337 0.53
338 0.46
339 0.39
340 0.33
341 0.33
342 0.39
343 0.45
344 0.47
345 0.53
346 0.62
347 0.72