Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7S3G1

Protein Details
Accession S7S3G1    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPSARRTRSKRGIEANQEASHydrophilic
NLS Segment(s)
PositionSequence
10-11KR
20-29SSRPGKKPRK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
KEGG gtr:GLOTRDRAFT_52488  -  
Pfam View protein in Pfam  
PF00646  F-box  
PROSITE View protein in PROSITE  
PS50181  FBOX  
CDD cd09917  F-box_SF  
Amino Acid Sequences MPSARRTRSKRGIEANQEASSRPGKKPRKSAAIQETGKAEHADLVHGELTSSLDRLPELPIDVLYEIFGHLAPEDLLRLARSNKSFRNLLLSRSSAVAWRTARHNAPALPNCPPYLSEPKYASLMFESHCYNCGVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.76
3 0.69
4 0.61
5 0.52
6 0.46
7 0.43
8 0.38
9 0.35
10 0.39
11 0.46
12 0.53
13 0.63
14 0.68
15 0.71
16 0.71
17 0.76
18 0.75
19 0.75
20 0.68
21 0.6
22 0.53
23 0.44
24 0.42
25 0.32
26 0.22
27 0.15
28 0.14
29 0.12
30 0.1
31 0.1
32 0.1
33 0.09
34 0.09
35 0.07
36 0.08
37 0.07
38 0.08
39 0.06
40 0.06
41 0.06
42 0.07
43 0.08
44 0.06
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.04
56 0.04
57 0.03
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.08
67 0.12
68 0.16
69 0.21
70 0.24
71 0.28
72 0.29
73 0.28
74 0.35
75 0.32
76 0.32
77 0.32
78 0.29
79 0.26
80 0.26
81 0.26
82 0.19
83 0.19
84 0.21
85 0.18
86 0.19
87 0.22
88 0.27
89 0.28
90 0.29
91 0.32
92 0.3
93 0.38
94 0.41
95 0.4
96 0.4
97 0.4
98 0.37
99 0.34
100 0.33
101 0.3
102 0.34
103 0.35
104 0.36
105 0.36
106 0.38
107 0.4
108 0.39
109 0.34
110 0.26
111 0.25
112 0.19
113 0.2
114 0.22
115 0.19
116 0.21