Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RU72

Protein Details
Accession S7RU72    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
356-375QSARERYLARKRQRLEQQSQHydrophilic
NLS Segment(s)
PositionSequence
102-104KER
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018612  NSRP1_N  
Gene Ontology GO:0000381  P:regulation of alternative mRNA splicing, via spliceosome  
KEGG gtr:GLOTRDRAFT_57089  -  
Pfam View protein in Pfam  
PF09745  NSRP1_N  
Amino Acid Sequences MKLSFSLTNKSKPAGAAPPLKPPSAFASLDDDVDAAPTASADGKASVNKKLVAQNVGTSKATRKKMEQEQKLDSSVFEYDEVYEKMQEAKARQKLAKEAEAKERKPKYIAGLLQSAATRRLDHLRAEEKMIQREREMEGDEFKDKEAFVTQAYKDQLAEVRRAEEEEKRREEEEKKKNKGLTTGMVHFYRQLLEESEKEHEETIAAVNAEQTQKVAGPSMPNLTISKPADYVPKSDVELAKLASAEGKQVELNDDNQIVDKRELLSAGLNLSLPNTRRLGLKTSTSQKKDANGNDVQVHTAVGTAASRREIDERRRREVLKQMEEERERMAREKEQKEKEATARIAAKRNNEESVQSARERYLARKRQRLEQQSQSSPPPEGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.45
4 0.44
5 0.53
6 0.54
7 0.53
8 0.48
9 0.42
10 0.41
11 0.37
12 0.35
13 0.27
14 0.31
15 0.31
16 0.31
17 0.29
18 0.23
19 0.16
20 0.16
21 0.15
22 0.07
23 0.06
24 0.05
25 0.06
26 0.07
27 0.07
28 0.07
29 0.09
30 0.11
31 0.17
32 0.19
33 0.24
34 0.26
35 0.27
36 0.31
37 0.35
38 0.38
39 0.36
40 0.35
41 0.36
42 0.37
43 0.39
44 0.36
45 0.32
46 0.35
47 0.39
48 0.44
49 0.42
50 0.44
51 0.5
52 0.6
53 0.69
54 0.7
55 0.7
56 0.71
57 0.7
58 0.67
59 0.57
60 0.46
61 0.38
62 0.3
63 0.23
64 0.16
65 0.13
66 0.11
67 0.15
68 0.16
69 0.14
70 0.13
71 0.13
72 0.15
73 0.17
74 0.19
75 0.2
76 0.28
77 0.33
78 0.39
79 0.41
80 0.42
81 0.47
82 0.49
83 0.53
84 0.49
85 0.48
86 0.52
87 0.59
88 0.58
89 0.6
90 0.59
91 0.54
92 0.5
93 0.48
94 0.43
95 0.42
96 0.43
97 0.37
98 0.36
99 0.33
100 0.33
101 0.31
102 0.26
103 0.2
104 0.18
105 0.14
106 0.14
107 0.19
108 0.19
109 0.21
110 0.26
111 0.29
112 0.3
113 0.34
114 0.37
115 0.35
116 0.41
117 0.43
118 0.37
119 0.33
120 0.34
121 0.32
122 0.28
123 0.27
124 0.2
125 0.19
126 0.2
127 0.21
128 0.19
129 0.18
130 0.16
131 0.13
132 0.13
133 0.12
134 0.1
135 0.09
136 0.14
137 0.14
138 0.18
139 0.19
140 0.19
141 0.17
142 0.17
143 0.2
144 0.17
145 0.2
146 0.15
147 0.16
148 0.16
149 0.17
150 0.18
151 0.21
152 0.27
153 0.31
154 0.34
155 0.35
156 0.36
157 0.39
158 0.45
159 0.49
160 0.52
161 0.55
162 0.57
163 0.6
164 0.62
165 0.58
166 0.55
167 0.47
168 0.42
169 0.36
170 0.33
171 0.32
172 0.29
173 0.28
174 0.24
175 0.21
176 0.16
177 0.13
178 0.1
179 0.09
180 0.11
181 0.11
182 0.13
183 0.14
184 0.14
185 0.14
186 0.13
187 0.11
188 0.09
189 0.09
190 0.08
191 0.07
192 0.06
193 0.06
194 0.06
195 0.08
196 0.08
197 0.08
198 0.07
199 0.06
200 0.07
201 0.07
202 0.08
203 0.07
204 0.08
205 0.09
206 0.11
207 0.11
208 0.12
209 0.13
210 0.12
211 0.18
212 0.17
213 0.17
214 0.16
215 0.16
216 0.22
217 0.22
218 0.23
219 0.19
220 0.2
221 0.19
222 0.22
223 0.22
224 0.17
225 0.18
226 0.16
227 0.15
228 0.13
229 0.12
230 0.1
231 0.09
232 0.09
233 0.08
234 0.08
235 0.08
236 0.08
237 0.11
238 0.11
239 0.12
240 0.13
241 0.13
242 0.12
243 0.14
244 0.15
245 0.15
246 0.14
247 0.14
248 0.13
249 0.13
250 0.13
251 0.12
252 0.12
253 0.1
254 0.1
255 0.09
256 0.08
257 0.08
258 0.09
259 0.12
260 0.12
261 0.14
262 0.15
263 0.15
264 0.18
265 0.2
266 0.25
267 0.25
268 0.29
269 0.33
270 0.42
271 0.5
272 0.51
273 0.54
274 0.52
275 0.54
276 0.57
277 0.54
278 0.5
279 0.44
280 0.44
281 0.42
282 0.39
283 0.34
284 0.26
285 0.22
286 0.15
287 0.12
288 0.09
289 0.06
290 0.06
291 0.07
292 0.08
293 0.1
294 0.1
295 0.12
296 0.18
297 0.25
298 0.35
299 0.45
300 0.5
301 0.55
302 0.62
303 0.62
304 0.62
305 0.65
306 0.64
307 0.63
308 0.63
309 0.62
310 0.65
311 0.65
312 0.6
313 0.54
314 0.47
315 0.4
316 0.38
317 0.37
318 0.36
319 0.44
320 0.51
321 0.57
322 0.62
323 0.66
324 0.67
325 0.69
326 0.66
327 0.65
328 0.58
329 0.55
330 0.55
331 0.54
332 0.56
333 0.54
334 0.56
335 0.55
336 0.58
337 0.55
338 0.48
339 0.45
340 0.41
341 0.44
342 0.4
343 0.35
344 0.32
345 0.29
346 0.33
347 0.34
348 0.38
349 0.42
350 0.48
351 0.56
352 0.64
353 0.67
354 0.72
355 0.8
356 0.81
357 0.79
358 0.8
359 0.79
360 0.77
361 0.78
362 0.74
363 0.66