Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QHA3

Protein Details
Accession S7QHA3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGWVKKRREKRERERKEQEERERAERBasic
NLS Segment(s)
PositionSequence
5-27KKRREKRERERKEQEERERAERE
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 3
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_137293  -  
Amino Acid Sequences MGWVKKRREKRERERKEQEERERAEREKANPEIRVSAPQEEVESKEEEKPVEVVAEKDAPVDEEEEEAPQVVAEKEEPEHVYTTVAVPVVQAHPHPSRTHSHSEEERERAKSPPALMTPSANEDEEDDDEEESPRSEEASAEGIPEEDEDEEDEDEEEEERRRVTALGAGLEKVSRHKEADERER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.92
4 0.91
5 0.9
6 0.89
7 0.83
8 0.8
9 0.75
10 0.68
11 0.65
12 0.6
13 0.55
14 0.53
15 0.56
16 0.54
17 0.51
18 0.5
19 0.47
20 0.42
21 0.44
22 0.38
23 0.34
24 0.29
25 0.27
26 0.27
27 0.24
28 0.25
29 0.21
30 0.2
31 0.19
32 0.2
33 0.21
34 0.19
35 0.19
36 0.17
37 0.15
38 0.14
39 0.13
40 0.11
41 0.12
42 0.13
43 0.12
44 0.12
45 0.11
46 0.1
47 0.1
48 0.11
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.08
64 0.09
65 0.1
66 0.11
67 0.1
68 0.1
69 0.1
70 0.1
71 0.09
72 0.08
73 0.07
74 0.05
75 0.06
76 0.07
77 0.07
78 0.06
79 0.1
80 0.12
81 0.14
82 0.15
83 0.16
84 0.2
85 0.24
86 0.31
87 0.29
88 0.32
89 0.34
90 0.41
91 0.42
92 0.42
93 0.41
94 0.37
95 0.36
96 0.33
97 0.32
98 0.28
99 0.25
100 0.25
101 0.23
102 0.23
103 0.23
104 0.23
105 0.21
106 0.22
107 0.21
108 0.17
109 0.15
110 0.13
111 0.14
112 0.14
113 0.14
114 0.12
115 0.11
116 0.11
117 0.12
118 0.11
119 0.09
120 0.09
121 0.07
122 0.07
123 0.07
124 0.07
125 0.08
126 0.11
127 0.1
128 0.1
129 0.1
130 0.1
131 0.1
132 0.1
133 0.09
134 0.06
135 0.06
136 0.07
137 0.08
138 0.08
139 0.09
140 0.09
141 0.08
142 0.08
143 0.09
144 0.09
145 0.1
146 0.11
147 0.11
148 0.11
149 0.11
150 0.11
151 0.12
152 0.15
153 0.15
154 0.18
155 0.19
156 0.19
157 0.19
158 0.2
159 0.2
160 0.2
161 0.23
162 0.22
163 0.22
164 0.26
165 0.33