Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7QC16

Protein Details
Accession S7QC16    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
118-137ASPRCSIERLKKEEKCKKKEBasic
139-171EAEEKERKERKEQERKEQERKKRQEEVKEEEERAcidic
NLS Segment(s)
PositionSequence
128-163KKEEKCKKKEEEAEEKERKERKEQERKEQERKKRQE
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.333
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_137382  -  
Amino Acid Sequences MASGTCRRKAFFLNSIIRKATSLMLLPVHPGRPILCLCLPHSTPSSSASSISSPPSTSTSLRPVLPVGNAWLNTGASAFVPRQSKVFIKAADGKEVDLQELRKQQAQAGAPIALPSPASPRCSIERLKKEEKCKKKEEEAEEKERKERKEQERKEQERKKRQEEVKEEEERQGGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.57
4 0.51
5 0.44
6 0.38
7 0.31
8 0.23
9 0.19
10 0.17
11 0.17
12 0.16
13 0.19
14 0.2
15 0.19
16 0.17
17 0.17
18 0.15
19 0.17
20 0.18
21 0.19
22 0.19
23 0.2
24 0.22
25 0.27
26 0.28
27 0.27
28 0.29
29 0.25
30 0.24
31 0.25
32 0.26
33 0.2
34 0.2
35 0.18
36 0.18
37 0.18
38 0.19
39 0.17
40 0.14
41 0.15
42 0.17
43 0.18
44 0.18
45 0.2
46 0.22
47 0.24
48 0.24
49 0.23
50 0.21
51 0.2
52 0.18
53 0.16
54 0.13
55 0.13
56 0.13
57 0.12
58 0.12
59 0.11
60 0.1
61 0.1
62 0.07
63 0.05
64 0.06
65 0.06
66 0.09
67 0.11
68 0.11
69 0.12
70 0.14
71 0.15
72 0.18
73 0.21
74 0.18
75 0.19
76 0.26
77 0.26
78 0.28
79 0.27
80 0.23
81 0.22
82 0.22
83 0.19
84 0.13
85 0.13
86 0.14
87 0.18
88 0.19
89 0.19
90 0.2
91 0.2
92 0.24
93 0.24
94 0.22
95 0.19
96 0.19
97 0.16
98 0.16
99 0.14
100 0.09
101 0.08
102 0.07
103 0.1
104 0.12
105 0.14
106 0.15
107 0.18
108 0.22
109 0.26
110 0.33
111 0.38
112 0.45
113 0.5
114 0.59
115 0.63
116 0.7
117 0.76
118 0.8
119 0.79
120 0.78
121 0.77
122 0.77
123 0.79
124 0.78
125 0.78
126 0.76
127 0.78
128 0.77
129 0.73
130 0.71
131 0.68
132 0.62
133 0.6
134 0.62
135 0.63
136 0.67
137 0.73
138 0.77
139 0.82
140 0.88
141 0.9
142 0.9
143 0.9
144 0.89
145 0.91
146 0.88
147 0.87
148 0.86
149 0.86
150 0.85
151 0.82
152 0.8
153 0.78
154 0.72
155 0.66