Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QBS9

Protein Details
Accession S7QBS9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-116EYQPSQRVRKRRHGFLARKKSQHGPKILARRRAKGRKFBasic
NLS Segment(s)
PositionSequence
85-116RVRKRRHGFLARKKSQHGPKILARRRAKGRKF
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG gtr:GLOTRDRAFT_99384  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIFRQVALALARPPTLSQASSTVSSLLQSQRLSTPRPTVLAPSIAFQSHSLLAPTFTGLPSALLRLNQVRWGSRGTEYQPSQRVRKRRHGFLARKKSQHGPKILARRRAKGRKFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.2
4 0.19
5 0.17
6 0.16
7 0.18
8 0.2
9 0.21
10 0.21
11 0.18
12 0.15
13 0.15
14 0.16
15 0.15
16 0.16
17 0.15
18 0.16
19 0.2
20 0.23
21 0.26
22 0.26
23 0.29
24 0.27
25 0.28
26 0.27
27 0.25
28 0.24
29 0.25
30 0.22
31 0.18
32 0.17
33 0.16
34 0.16
35 0.13
36 0.13
37 0.1
38 0.1
39 0.09
40 0.08
41 0.08
42 0.08
43 0.08
44 0.06
45 0.05
46 0.06
47 0.05
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.08
54 0.1
55 0.1
56 0.13
57 0.15
58 0.15
59 0.15
60 0.17
61 0.18
62 0.18
63 0.21
64 0.2
65 0.27
66 0.28
67 0.32
68 0.38
69 0.41
70 0.47
71 0.5
72 0.57
73 0.57
74 0.66
75 0.68
76 0.69
77 0.76
78 0.78
79 0.83
80 0.84
81 0.88
82 0.85
83 0.82
84 0.78
85 0.77
86 0.75
87 0.73
88 0.68
89 0.64
90 0.64
91 0.71
92 0.74
93 0.75
94 0.72
95 0.73
96 0.77
97 0.81
98 0.79
99 0.79