Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7RXL2

Protein Details
Accession S7RXL2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
4-26RQGGKLKPLKAPKKDKKDEDEEDBasic
NLS Segment(s)
PositionSequence
6-63GGKLKPLKAPKKDKKDEDEEDKVFKERKKAEEKALKEAREKAAKGGAPGGGIKKSGKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
KEGG gtr:GLOTRDRAFT_136875  -  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MSGRQGGKLKPLKAPKKDKKDEDEEDKVFKERKKAEEKALKEAREKAAKGGAPGGGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.79
4 0.86
5 0.85
6 0.82
7 0.81
8 0.78
9 0.75
10 0.72
11 0.63
12 0.56
13 0.5
14 0.45
15 0.4
16 0.34
17 0.33
18 0.3
19 0.36
20 0.42
21 0.45
22 0.51
23 0.56
24 0.57
25 0.6
26 0.62
27 0.57
28 0.52
29 0.53
30 0.5
31 0.48
32 0.46
33 0.38
34 0.38
35 0.37
36 0.35
37 0.32
38 0.26
39 0.21
40 0.23
41 0.23
42 0.18
43 0.19