Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QDW9

Protein Details
Accession S7QDW9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
118-147PTNTTTSGKPKPQPKPQPKPKPTKPTNGVKHydrophilic
NLS Segment(s)
PositionSequence
124-145SGKPKPQPKPQPKPKPTKPTNG
Subcellular Location(s) nucl 11, cyto_nucl 10, mito 8, cyto 7
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_92501  -  
Amino Acid Sequences MSTVQNAVAVTENTTSSIMKQPSSEKIGQYATDTNGTLPSGTAVHVEVKPMLPNGRVGKEGTKDFPNNLLARASNQSHHFAMAPETYDSVSVKVQTASTAPASMAQPPRKGLYKPRGPTNTTTSGKPKPQPKPQPKPKPTKPTNGVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.2
5 0.2
6 0.2
7 0.22
8 0.25
9 0.3
10 0.36
11 0.37
12 0.3
13 0.33
14 0.34
15 0.32
16 0.31
17 0.28
18 0.23
19 0.22
20 0.21
21 0.18
22 0.17
23 0.16
24 0.13
25 0.1
26 0.09
27 0.07
28 0.07
29 0.07
30 0.07
31 0.1
32 0.1
33 0.11
34 0.11
35 0.11
36 0.12
37 0.13
38 0.13
39 0.11
40 0.16
41 0.18
42 0.19
43 0.2
44 0.2
45 0.22
46 0.24
47 0.25
48 0.23
49 0.24
50 0.23
51 0.23
52 0.25
53 0.25
54 0.22
55 0.21
56 0.19
57 0.15
58 0.16
59 0.18
60 0.16
61 0.15
62 0.16
63 0.18
64 0.17
65 0.18
66 0.16
67 0.13
68 0.14
69 0.12
70 0.11
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.08
77 0.08
78 0.08
79 0.08
80 0.09
81 0.09
82 0.08
83 0.09
84 0.1
85 0.1
86 0.09
87 0.09
88 0.1
89 0.11
90 0.16
91 0.23
92 0.25
93 0.27
94 0.28
95 0.32
96 0.33
97 0.36
98 0.4
99 0.43
100 0.49
101 0.52
102 0.6
103 0.63
104 0.63
105 0.65
106 0.63
107 0.62
108 0.54
109 0.53
110 0.51
111 0.52
112 0.56
113 0.58
114 0.61
115 0.61
116 0.7
117 0.76
118 0.81
119 0.85
120 0.88
121 0.93
122 0.93
123 0.94
124 0.94
125 0.94
126 0.9
127 0.9