Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7PUR0

Protein Details
Accession S7PUR0    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
164-188EENREKWGPRRRMVREIQKERRAYWBasic
NLS Segment(s)
PositionSequence
167-178REKWGPRRRMVR
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
KEGG gtr:GLOTRDRAFT_81601  -  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MKPRLQVGRLLGTRSYATKVTPRKPMPAERPPQKYADPLASSPVAVATALPDNLTFIHRPPPSAPSPHSYTTLPASPLLRPPAGHSAQGVPPHIRPSAKKTPPPRMSDEDLTELKRLRYADPKTWTRAALARKFNCTKQFVGLVTCLPNTVRKEIKAVKAVKDEENREKWGPRRRMVREIQKERRAYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.21
4 0.22
5 0.28
6 0.36
7 0.4
8 0.49
9 0.5
10 0.55
11 0.61
12 0.68
13 0.69
14 0.7
15 0.74
16 0.73
17 0.77
18 0.71
19 0.69
20 0.61
21 0.55
22 0.49
23 0.46
24 0.4
25 0.33
26 0.34
27 0.3
28 0.28
29 0.24
30 0.2
31 0.12
32 0.09
33 0.08
34 0.06
35 0.07
36 0.07
37 0.08
38 0.07
39 0.08
40 0.08
41 0.11
42 0.1
43 0.09
44 0.18
45 0.18
46 0.2
47 0.21
48 0.26
49 0.27
50 0.31
51 0.32
52 0.29
53 0.34
54 0.34
55 0.35
56 0.3
57 0.28
58 0.26
59 0.26
60 0.21
61 0.18
62 0.17
63 0.16
64 0.19
65 0.2
66 0.17
67 0.15
68 0.17
69 0.23
70 0.23
71 0.22
72 0.2
73 0.19
74 0.21
75 0.23
76 0.22
77 0.16
78 0.15
79 0.17
80 0.18
81 0.17
82 0.16
83 0.23
84 0.32
85 0.36
86 0.42
87 0.46
88 0.56
89 0.61
90 0.64
91 0.62
92 0.57
93 0.57
94 0.53
95 0.48
96 0.42
97 0.36
98 0.33
99 0.29
100 0.24
101 0.2
102 0.19
103 0.18
104 0.17
105 0.24
106 0.28
107 0.34
108 0.4
109 0.44
110 0.46
111 0.47
112 0.45
113 0.38
114 0.39
115 0.39
116 0.39
117 0.45
118 0.42
119 0.48
120 0.51
121 0.54
122 0.56
123 0.51
124 0.45
125 0.39
126 0.4
127 0.33
128 0.32
129 0.28
130 0.23
131 0.21
132 0.19
133 0.17
134 0.14
135 0.19
136 0.19
137 0.25
138 0.26
139 0.26
140 0.34
141 0.4
142 0.46
143 0.48
144 0.5
145 0.5
146 0.53
147 0.56
148 0.56
149 0.57
150 0.57
151 0.58
152 0.59
153 0.59
154 0.55
155 0.58
156 0.59
157 0.62
158 0.63
159 0.62
160 0.67
161 0.69
162 0.75
163 0.78
164 0.81
165 0.82
166 0.84
167 0.87
168 0.85