Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0B5K1

Protein Details
Accession X0B5K1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-74RSYNNHFRKWKIRKYNCKKRNHKPRMSPTSKASHydrophilic
NLS Segment(s)
PositionSequence
51-66WKIRKYNCKKRNHKPR
Subcellular Location(s) nucl 13.5, cyto_nucl 10.833, mito_nucl 10.666, mito 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MKAKPWGEHKDIIVQLYCNERRTLKDVRSIMREHHSFDASARSYNNHFRKWKIRKYNCKKRNHKPRMSPTSKASVSGSRSPPNVPVKEEVSETLSFTTSRRQSSPYRLPLAEMGRTGYPDYKWPQWTRPDETMLDNLYTPTQIMLPPITAFRQENDSTTGARHLQSLSDIYFTQLCDLNGPCHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.35
4 0.36
5 0.3
6 0.31
7 0.3
8 0.32
9 0.37
10 0.42
11 0.37
12 0.43
13 0.46
14 0.49
15 0.52
16 0.5
17 0.49
18 0.5
19 0.47
20 0.42
21 0.4
22 0.36
23 0.3
24 0.3
25 0.32
26 0.25
27 0.25
28 0.22
29 0.21
30 0.24
31 0.34
32 0.39
33 0.39
34 0.42
35 0.46
36 0.56
37 0.63
38 0.69
39 0.71
40 0.75
41 0.79
42 0.87
43 0.92
44 0.91
45 0.92
46 0.92
47 0.91
48 0.92
49 0.92
50 0.9
51 0.89
52 0.91
53 0.91
54 0.87
55 0.8
56 0.72
57 0.7
58 0.6
59 0.51
60 0.42
61 0.35
62 0.34
63 0.36
64 0.35
65 0.3
66 0.31
67 0.3
68 0.34
69 0.37
70 0.34
71 0.29
72 0.28
73 0.27
74 0.27
75 0.27
76 0.21
77 0.18
78 0.16
79 0.15
80 0.12
81 0.11
82 0.1
83 0.1
84 0.16
85 0.16
86 0.17
87 0.18
88 0.22
89 0.25
90 0.34
91 0.43
92 0.42
93 0.44
94 0.42
95 0.41
96 0.42
97 0.4
98 0.33
99 0.24
100 0.2
101 0.16
102 0.17
103 0.16
104 0.14
105 0.12
106 0.16
107 0.19
108 0.23
109 0.29
110 0.31
111 0.37
112 0.44
113 0.49
114 0.5
115 0.5
116 0.49
117 0.44
118 0.43
119 0.4
120 0.33
121 0.28
122 0.21
123 0.18
124 0.15
125 0.13
126 0.11
127 0.08
128 0.07
129 0.07
130 0.08
131 0.09
132 0.09
133 0.1
134 0.12
135 0.12
136 0.15
137 0.15
138 0.15
139 0.21
140 0.21
141 0.22
142 0.25
143 0.25
144 0.23
145 0.23
146 0.25
147 0.21
148 0.2
149 0.2
150 0.16
151 0.16
152 0.17
153 0.19
154 0.16
155 0.17
156 0.16
157 0.17
158 0.18
159 0.17
160 0.17
161 0.17
162 0.16
163 0.18
164 0.2