Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0BL97

Protein Details
Accession X0BL97    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
131-151ELIKKNKEKINRNREASKNYKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MSQSDSEHQEAAHTEETCPGITYKYLSPEQQEMSDILYKMECHDLDLLGIVHLGHDGIFRYLDADRNIHYAIALRPALIKALLDRGPYNKEEETVFRGVDGTKVPKEQWYNPPLGILPEPLSEEHRKEGQELIKKNKEKINRNREASKNYKERLVYIESDHKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.23
4 0.22
5 0.21
6 0.18
7 0.14
8 0.14
9 0.17
10 0.16
11 0.2
12 0.23
13 0.23
14 0.27
15 0.29
16 0.3
17 0.28
18 0.27
19 0.22
20 0.22
21 0.24
22 0.2
23 0.16
24 0.15
25 0.14
26 0.15
27 0.18
28 0.15
29 0.13
30 0.14
31 0.13
32 0.12
33 0.13
34 0.12
35 0.07
36 0.08
37 0.06
38 0.05
39 0.05
40 0.04
41 0.03
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.07
48 0.07
49 0.11
50 0.11
51 0.12
52 0.12
53 0.14
54 0.15
55 0.13
56 0.12
57 0.11
58 0.1
59 0.13
60 0.12
61 0.1
62 0.1
63 0.11
64 0.11
65 0.09
66 0.08
67 0.05
68 0.09
69 0.1
70 0.1
71 0.11
72 0.13
73 0.15
74 0.16
75 0.19
76 0.15
77 0.15
78 0.15
79 0.16
80 0.19
81 0.18
82 0.17
83 0.13
84 0.14
85 0.13
86 0.13
87 0.14
88 0.13
89 0.13
90 0.15
91 0.15
92 0.2
93 0.24
94 0.28
95 0.35
96 0.34
97 0.36
98 0.34
99 0.35
100 0.3
101 0.28
102 0.23
103 0.16
104 0.14
105 0.12
106 0.13
107 0.13
108 0.18
109 0.19
110 0.2
111 0.22
112 0.24
113 0.24
114 0.24
115 0.3
116 0.32
117 0.37
118 0.42
119 0.48
120 0.54
121 0.57
122 0.61
123 0.61
124 0.64
125 0.66
126 0.7
127 0.72
128 0.73
129 0.76
130 0.8
131 0.81
132 0.81
133 0.79
134 0.78
135 0.76
136 0.68
137 0.68
138 0.6
139 0.55
140 0.51
141 0.47
142 0.4
143 0.36
144 0.44