Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CTE8

Protein Details
Accession X0CTE8   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-123EVYESPKVTPRKRRAPKTPESDSKAHydrophilic
NLS Segment(s)
PositionSequence
78-92KKATSARKRGPKAKK
108-116PRKRRAPKT
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MSDAAVKPNAWTDEAKNELLLRIIAQLKPEGKSINWSEINMEGRTVKSLQNQWTFFNKKLEAFKTQSNDGSTPSTPAKKATSARKRGPKAKKVAPDDDEVYESPKVTPRKRRAPKTPESDSKAVKKEPSEAVVKDEEMEDDRDVDGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.28
4 0.27
5 0.25
6 0.23
7 0.21
8 0.13
9 0.14
10 0.16
11 0.16
12 0.17
13 0.21
14 0.22
15 0.23
16 0.25
17 0.22
18 0.19
19 0.26
20 0.27
21 0.3
22 0.29
23 0.28
24 0.27
25 0.3
26 0.33
27 0.26
28 0.24
29 0.17
30 0.16
31 0.18
32 0.18
33 0.16
34 0.18
35 0.23
36 0.3
37 0.35
38 0.36
39 0.37
40 0.44
41 0.46
42 0.43
43 0.42
44 0.37
45 0.33
46 0.37
47 0.37
48 0.34
49 0.34
50 0.35
51 0.33
52 0.34
53 0.32
54 0.29
55 0.27
56 0.23
57 0.23
58 0.18
59 0.18
60 0.18
61 0.18
62 0.16
63 0.18
64 0.17
65 0.19
66 0.24
67 0.33
68 0.4
69 0.47
70 0.55
71 0.62
72 0.67
73 0.72
74 0.77
75 0.75
76 0.73
77 0.72
78 0.73
79 0.7
80 0.7
81 0.63
82 0.58
83 0.51
84 0.44
85 0.39
86 0.3
87 0.27
88 0.2
89 0.18
90 0.15
91 0.19
92 0.24
93 0.3
94 0.4
95 0.46
96 0.57
97 0.67
98 0.76
99 0.81
100 0.83
101 0.86
102 0.84
103 0.84
104 0.82
105 0.8
106 0.76
107 0.71
108 0.69
109 0.65
110 0.6
111 0.55
112 0.48
113 0.46
114 0.45
115 0.43
116 0.41
117 0.36
118 0.37
119 0.35
120 0.33
121 0.28
122 0.24
123 0.21
124 0.18
125 0.2
126 0.16
127 0.15
128 0.15