X0CJI1
Protein Details
| Accession | X0CJI1  |
Localization Confidence | Low | Confidence Score | 7.4 | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| NoLS Segment(s) |
|
||||||||||
| NLS Segment(s) |
|
||||||||||
| Subcellular Location(s) | mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.833 | ||||||||||
| Family & Domain DBs |
|
||||||||||
| Amino Acid Sequences | MLMQKLKHSFSLKKRQRWPKQICMLAKKHVP | ||||||||||
| FASTA Sequence with NoLS information |
|||||||||||
| AlphaFold Structure with highlighted NoLS |
|||||||||||
NoLS Predictions per Residue
| Residue Number | Score |
|---|---|
| 1 | 0.75 |
| 2 | 0.8 |
| 3 | 0.84 |
| 4 | 0.86 |
| 5 | 0.85 |
| 6 | 0.84 |
| 7 | 0.85 |
| 8 | 0.84 |
| 9 | 0.82 |
| 10 | 0.8 |
| 11 | 0.75 |