Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0BM23

Protein Details
Accession X0BM23    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-28ATTTTVVRKDHKKWKCNKNISGRLCGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 12.333, mito 10.5, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MATTTTVVRKDHKKWKCNKNISGRLCGTVTSMSNIYCDKCDNRRQTDDEALTSDESSIGRMYHLDTSLTEHWEYTSPEPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.8
3 0.84
4 0.86
5 0.86
6 0.87
7 0.88
8 0.83
9 0.8
10 0.71
11 0.62
12 0.52
13 0.43
14 0.33
15 0.25
16 0.21
17 0.14
18 0.14
19 0.11
20 0.12
21 0.12
22 0.12
23 0.1
24 0.12
25 0.13
26 0.18
27 0.26
28 0.32
29 0.37
30 0.41
31 0.43
32 0.46
33 0.49
34 0.45
35 0.38
36 0.33
37 0.28
38 0.24
39 0.21
40 0.16
41 0.1
42 0.09
43 0.09
44 0.08
45 0.07
46 0.07
47 0.07
48 0.09
49 0.11
50 0.12
51 0.12
52 0.12
53 0.18
54 0.2
55 0.23
56 0.21
57 0.18
58 0.19
59 0.21
60 0.25