Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GYD7

Protein Details
Accession C1GYD7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-40MLIQKRWEEGRRERRERKEMSRAABasic
NLS Segment(s)
PositionSequence
26-34GRRERRERK
Subcellular Location(s) mito 11, cyto 5, nucl 4, pero 2, E.R. 2, plas 1, cysk 1, vacu 1
Family & Domain DBs
KEGG pbl:PAAG_03091  -  
Amino Acid Sequences MEQELSSYTGLKQMKLMLIQKRWEEGRRERRERKEMSRAAEEKESGNVSESFQATGGGGEWVRYRIVGVQYGGAKRLVTCLVPLWHTVGHCWSLGTPDAPQEEGWERLAEAGRWPIIEACGGWSPSLCGINLGLETVSMANLSCVSVLLLPYCRIAVPLVLGLPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.33
4 0.35
5 0.4
6 0.45
7 0.45
8 0.47
9 0.49
10 0.49
11 0.5
12 0.53
13 0.59
14 0.64
15 0.72
16 0.77
17 0.81
18 0.85
19 0.85
20 0.83
21 0.83
22 0.78
23 0.73
24 0.73
25 0.65
26 0.6
27 0.55
28 0.47
29 0.37
30 0.34
31 0.29
32 0.19
33 0.2
34 0.16
35 0.14
36 0.16
37 0.16
38 0.13
39 0.12
40 0.12
41 0.1
42 0.09
43 0.08
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.09
53 0.1
54 0.11
55 0.11
56 0.13
57 0.16
58 0.16
59 0.17
60 0.14
61 0.13
62 0.11
63 0.12
64 0.1
65 0.08
66 0.08
67 0.09
68 0.09
69 0.1
70 0.11
71 0.1
72 0.1
73 0.1
74 0.1
75 0.1
76 0.1
77 0.09
78 0.09
79 0.08
80 0.08
81 0.09
82 0.09
83 0.08
84 0.09
85 0.1
86 0.1
87 0.1
88 0.12
89 0.13
90 0.14
91 0.14
92 0.12
93 0.11
94 0.12
95 0.13
96 0.11
97 0.1
98 0.11
99 0.11
100 0.11
101 0.11
102 0.1
103 0.1
104 0.1
105 0.08
106 0.09
107 0.11
108 0.12
109 0.11
110 0.11
111 0.11
112 0.13
113 0.14
114 0.11
115 0.09
116 0.09
117 0.1
118 0.1
119 0.1
120 0.07
121 0.06
122 0.07
123 0.06
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.07
135 0.09
136 0.11
137 0.12
138 0.13
139 0.13
140 0.13
141 0.13
142 0.13
143 0.12
144 0.11
145 0.12
146 0.12