Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CP82

Protein Details
Accession Q6CP82   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-31AASLHPKIVKKHTKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
9-23IVKKHTKKFKRHHSD
Subcellular Location(s) mito 12.5, mito_nucl 11, nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG kla:KLLA0_E06843g  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSVVRRRFRGNISEPTIGYGSNKKTKFMGPDGRKVVLVSNVKGLTPLLMHTKTFAAEIAHNVSSKNRIAILAEAKKNGIKVTNAKARLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.9
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.93
10 0.92
11 0.91
12 0.86
13 0.76
14 0.71
15 0.71
16 0.71
17 0.71
18 0.7
19 0.64
20 0.59
21 0.58
22 0.61
23 0.57
24 0.53
25 0.5
26 0.49
27 0.56
28 0.64
29 0.67
30 0.6
31 0.56
32 0.52
33 0.47
34 0.47
35 0.42
36 0.41
37 0.43
38 0.44
39 0.41
40 0.39
41 0.36
42 0.28
43 0.23
44 0.19
45 0.18
46 0.24
47 0.24
48 0.23
49 0.24
50 0.26
51 0.29
52 0.31
53 0.37
54 0.33
55 0.41
56 0.43
57 0.42
58 0.4
59 0.36
60 0.31
61 0.27
62 0.26
63 0.19
64 0.2
65 0.2
66 0.19
67 0.19
68 0.18
69 0.12
70 0.1
71 0.11
72 0.12
73 0.12
74 0.13
75 0.14
76 0.14
77 0.14
78 0.14
79 0.14
80 0.1
81 0.1
82 0.12
83 0.15
84 0.16
85 0.16
86 0.16
87 0.17
88 0.19
89 0.19
90 0.18
91 0.15
92 0.14
93 0.15
94 0.19
95 0.27
96 0.31
97 0.33
98 0.33
99 0.34
100 0.35
101 0.34
102 0.32
103 0.26
104 0.24
105 0.28
106 0.36
107 0.44
108 0.45
109 0.45
110 0.46