Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0CEF4

Protein Details
Accession X0CEF4    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-41WVPRKYLKWKWLNKTCRLPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, mito 10, cyto_mito 9.166, nucl 9, cyto_nucl 8.666, cyto 7
Family & Domain DBs
Amino Acid Sequences MDQPGINNTAAVPCRNVKAGAWVPRKYLKWKWLNKTCRLPSSITSSVAGKFKHDSFVSGEWGSDSKSCCLVTYSLLRDEFAGMQHIESENCVSKYLTLDTELRQRHCIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.19
5 0.26
6 0.32
7 0.39
8 0.44
9 0.43
10 0.45
11 0.51
12 0.54
13 0.52
14 0.53
15 0.52
16 0.55
17 0.62
18 0.69
19 0.72
20 0.77
21 0.78
22 0.82
23 0.77
24 0.72
25 0.65
26 0.57
27 0.5
28 0.5
29 0.44
30 0.35
31 0.3
32 0.26
33 0.26
34 0.26
35 0.24
36 0.17
37 0.17
38 0.16
39 0.19
40 0.18
41 0.17
42 0.17
43 0.18
44 0.2
45 0.17
46 0.17
47 0.13
48 0.14
49 0.13
50 0.11
51 0.11
52 0.09
53 0.11
54 0.11
55 0.11
56 0.12
57 0.12
58 0.14
59 0.18
60 0.19
61 0.21
62 0.22
63 0.21
64 0.2
65 0.21
66 0.19
67 0.14
68 0.14
69 0.1
70 0.1
71 0.11
72 0.12
73 0.11
74 0.11
75 0.14
76 0.15
77 0.15
78 0.17
79 0.15
80 0.16
81 0.19
82 0.2
83 0.18
84 0.17
85 0.19
86 0.22
87 0.3
88 0.35
89 0.35