Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BG70

Protein Details
Accession X0BG70    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
127-150RSQGHGHRGRRTRLERRRTAPRRQBasic
NLS Segment(s)
PositionSequence
121-150PGPRPIRSQGHGHRGRRTRLERRRTAPRRQ
Subcellular Location(s) cyto_nucl 10.5, cyto 10, nucl 9, mito 4, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022210  TF_GCR1-like  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF12550  GCR1_C  
Amino Acid Sequences MPVVAALAKAFTVRDVWKEWEEGIAGQPAVRVLEEKWRSRWRPENGVRVQFCRRKVTWDELLARTASGKNEEEAVAELELLRAGRSLNRLVDEFKQRRRRGQGQIRVQGGTLVPDDAGPGPGPRPIRSQGHGHRGRRTRLERRRTAPRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.24
4 0.25
5 0.27
6 0.26
7 0.24
8 0.23
9 0.2
10 0.18
11 0.16
12 0.14
13 0.12
14 0.12
15 0.11
16 0.1
17 0.1
18 0.09
19 0.07
20 0.18
21 0.24
22 0.27
23 0.34
24 0.43
25 0.46
26 0.53
27 0.62
28 0.59
29 0.64
30 0.68
31 0.71
32 0.68
33 0.73
34 0.67
35 0.63
36 0.64
37 0.58
38 0.54
39 0.51
40 0.44
41 0.42
42 0.44
43 0.46
44 0.43
45 0.44
46 0.45
47 0.39
48 0.4
49 0.34
50 0.29
51 0.24
52 0.19
53 0.14
54 0.12
55 0.12
56 0.1
57 0.11
58 0.12
59 0.11
60 0.1
61 0.1
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.04
69 0.03
70 0.04
71 0.05
72 0.07
73 0.09
74 0.1
75 0.12
76 0.13
77 0.15
78 0.2
79 0.28
80 0.32
81 0.39
82 0.49
83 0.5
84 0.56
85 0.63
86 0.67
87 0.67
88 0.72
89 0.73
90 0.73
91 0.77
92 0.72
93 0.64
94 0.55
95 0.46
96 0.35
97 0.27
98 0.18
99 0.11
100 0.08
101 0.08
102 0.09
103 0.08
104 0.09
105 0.07
106 0.08
107 0.08
108 0.12
109 0.15
110 0.16
111 0.2
112 0.25
113 0.3
114 0.33
115 0.42
116 0.47
117 0.55
118 0.63
119 0.63
120 0.67
121 0.7
122 0.74
123 0.74
124 0.76
125 0.76
126 0.77
127 0.83
128 0.83
129 0.83
130 0.87