Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BIK9

Protein Details
Accession X0BIK9   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSHPKVTRRKRRTETLKNKMKQYSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 14, mito 10.5
Family & Domain DBs
Amino Acid Sequences MSHPKVTRRKRRTETLKNKMKQYSHIFNVNITVIMQDRSTLQNQTFTFSPDHGWATTPSHSTNSPDRPEIATWPEGQNFVERLKQRFEQLNVECPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.91
4 0.85
5 0.85
6 0.81
7 0.72
8 0.69
9 0.66
10 0.63
11 0.57
12 0.58
13 0.51
14 0.44
15 0.44
16 0.36
17 0.27
18 0.19
19 0.15
20 0.09
21 0.09
22 0.08
23 0.07
24 0.08
25 0.1
26 0.11
27 0.13
28 0.12
29 0.18
30 0.18
31 0.2
32 0.19
33 0.18
34 0.18
35 0.16
36 0.17
37 0.12
38 0.13
39 0.11
40 0.12
41 0.11
42 0.14
43 0.15
44 0.15
45 0.15
46 0.16
47 0.16
48 0.19
49 0.24
50 0.28
51 0.3
52 0.29
53 0.3
54 0.31
55 0.31
56 0.31
57 0.28
58 0.23
59 0.23
60 0.24
61 0.24
62 0.22
63 0.22
64 0.22
65 0.19
66 0.2
67 0.24
68 0.26
69 0.28
70 0.33
71 0.35
72 0.37
73 0.43
74 0.45
75 0.48
76 0.48