Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CNX4

Protein Details
Accession X0CNX4   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
49-77YATMKPEQRKAKQDKKDKKKAGKTAKPSKBasic
NLS Segment(s)
PositionSequence
56-77QRKAKQDKKDKKKAGKTAKPSK
Subcellular Location(s) cyto 10.5, mito 7, cyto_nucl 6.5, extr 3, plas 2, nucl 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQFDWFSSIGATDEAVAVLNDQPIIFTILLVVLVAVILQIVLLWYIHYATMKPEQRKAKQDKKDKKKAGKTAKPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.08
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.02
21 0.02
22 0.02
23 0.02
24 0.01
25 0.01
26 0.01
27 0.01
28 0.01
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.04
35 0.04
36 0.05
37 0.07
38 0.16
39 0.23
40 0.26
41 0.34
42 0.42
43 0.49
44 0.59
45 0.67
46 0.68
47 0.72
48 0.8
49 0.83
50 0.86
51 0.9
52 0.9
53 0.91
54 0.91
55 0.92
56 0.92
57 0.91