Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BRD3

Protein Details
Accession X0BRD3   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-34ADRGSNPSNVDKRRRKYQDRRRRAMLPEDHydrophilic
NLS Segment(s)
PositionSequence
18-27RRRKYQDRRR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
Amino Acid Sequences MLLALADRGSNPSNVDKRRRKYQDRRRRAMLPEDDTFGTTSSEHSSISSSLKPLGTLPNSWCGISNEVIEIFGRLLALYRSACDYNQDQTTIGLKIASKALCDIAVARELEIELLSVDFKTIVLLEEPQDFYVDTRDDNTPVSHLLETAEAYRKAGLLQLYLTFDDLVVNASGGQNASASSSDDAKDKASRAKSLIDLTLELVTTLERIPAESGSRFIHPM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.51
3 0.57
4 0.63
5 0.73
6 0.81
7 0.83
8 0.86
9 0.89
10 0.9
11 0.91
12 0.92
13 0.88
14 0.85
15 0.8
16 0.79
17 0.77
18 0.71
19 0.62
20 0.57
21 0.51
22 0.44
23 0.38
24 0.28
25 0.2
26 0.14
27 0.13
28 0.13
29 0.13
30 0.12
31 0.12
32 0.13
33 0.14
34 0.17
35 0.17
36 0.14
37 0.16
38 0.16
39 0.16
40 0.16
41 0.21
42 0.2
43 0.22
44 0.23
45 0.26
46 0.27
47 0.27
48 0.27
49 0.22
50 0.23
51 0.21
52 0.19
53 0.14
54 0.13
55 0.13
56 0.11
57 0.1
58 0.07
59 0.06
60 0.05
61 0.04
62 0.05
63 0.05
64 0.07
65 0.06
66 0.07
67 0.09
68 0.1
69 0.1
70 0.13
71 0.15
72 0.16
73 0.17
74 0.17
75 0.15
76 0.16
77 0.17
78 0.15
79 0.13
80 0.1
81 0.09
82 0.09
83 0.12
84 0.11
85 0.09
86 0.09
87 0.1
88 0.09
89 0.09
90 0.08
91 0.06
92 0.08
93 0.08
94 0.07
95 0.07
96 0.07
97 0.07
98 0.06
99 0.05
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.05
112 0.06
113 0.08
114 0.09
115 0.09
116 0.09
117 0.09
118 0.08
119 0.1
120 0.1
121 0.08
122 0.1
123 0.11
124 0.11
125 0.12
126 0.12
127 0.11
128 0.11
129 0.13
130 0.1
131 0.1
132 0.09
133 0.09
134 0.09
135 0.11
136 0.14
137 0.13
138 0.13
139 0.13
140 0.13
141 0.12
142 0.14
143 0.12
144 0.09
145 0.1
146 0.11
147 0.12
148 0.12
149 0.13
150 0.1
151 0.1
152 0.09
153 0.08
154 0.08
155 0.06
156 0.06
157 0.06
158 0.06
159 0.07
160 0.06
161 0.06
162 0.05
163 0.05
164 0.06
165 0.06
166 0.08
167 0.09
168 0.11
169 0.12
170 0.13
171 0.14
172 0.16
173 0.18
174 0.19
175 0.26
176 0.28
177 0.31
178 0.32
179 0.35
180 0.36
181 0.36
182 0.36
183 0.3
184 0.27
185 0.25
186 0.24
187 0.2
188 0.16
189 0.12
190 0.1
191 0.09
192 0.08
193 0.09
194 0.07
195 0.09
196 0.1
197 0.12
198 0.16
199 0.16
200 0.19
201 0.2