Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BKZ0

Protein Details
Accession X0BKZ0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
315-339APVTPPKTGCSSKRRRARRAARRSLHydrophilic
NLS Segment(s)
PositionSequence
327-339KRRRARRAARRSL
Subcellular Location(s) extr 17, cyto 4.5, cyto_nucl 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005103  AA9  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF03443  AA9  
CDD cd21175  LPMO_AA9  
Amino Acid Sequences MRFSASAAALAMATTVSAHAQVYGLWVNGKDQGDGRNVYIRSPASNSPVKDLTSPDLVCNVNGAKAAPKFVKAASGDELTFEWYHDNRGDDIIDGSHKGPIITYIAPYTETDGTGAIWTKIAEDGYDGSEWAVDKLIKAKGKSTFTLPSALKAGKYIVRQEIIAHHESDVAYASNPARGAQFYPSCAQVEVTGSGTAVPDEKFDFNKGYTSTDKGIVFNLYGSYTTYDIPGPAVWKGTSSGSGSDSGSAPETPAATSAAAEAPAATSAAAEAPAATQPAGGNAGSETQAPAPTPTFATVVRPSEGASAPTEAPSAPVTPPKTGCSSKRRRARRAARRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.06
5 0.06
6 0.06
7 0.07
8 0.07
9 0.1
10 0.11
11 0.11
12 0.12
13 0.12
14 0.13
15 0.19
16 0.2
17 0.18
18 0.19
19 0.22
20 0.26
21 0.27
22 0.28
23 0.3
24 0.29
25 0.29
26 0.32
27 0.28
28 0.26
29 0.29
30 0.3
31 0.29
32 0.35
33 0.35
34 0.35
35 0.37
36 0.35
37 0.33
38 0.33
39 0.3
40 0.31
41 0.3
42 0.25
43 0.27
44 0.26
45 0.24
46 0.24
47 0.21
48 0.15
49 0.15
50 0.15
51 0.16
52 0.16
53 0.21
54 0.19
55 0.21
56 0.21
57 0.21
58 0.26
59 0.22
60 0.24
61 0.23
62 0.24
63 0.22
64 0.21
65 0.21
66 0.18
67 0.17
68 0.14
69 0.14
70 0.12
71 0.15
72 0.16
73 0.18
74 0.15
75 0.17
76 0.17
77 0.14
78 0.14
79 0.12
80 0.11
81 0.11
82 0.11
83 0.11
84 0.11
85 0.1
86 0.09
87 0.1
88 0.12
89 0.11
90 0.11
91 0.11
92 0.11
93 0.12
94 0.12
95 0.14
96 0.12
97 0.11
98 0.1
99 0.1
100 0.1
101 0.1
102 0.1
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.07
109 0.06
110 0.06
111 0.07
112 0.08
113 0.08
114 0.08
115 0.07
116 0.07
117 0.08
118 0.07
119 0.07
120 0.06
121 0.06
122 0.1
123 0.15
124 0.17
125 0.18
126 0.22
127 0.26
128 0.29
129 0.3
130 0.3
131 0.3
132 0.28
133 0.34
134 0.3
135 0.25
136 0.25
137 0.24
138 0.2
139 0.17
140 0.18
141 0.15
142 0.16
143 0.18
144 0.17
145 0.17
146 0.18
147 0.18
148 0.2
149 0.2
150 0.2
151 0.17
152 0.15
153 0.15
154 0.15
155 0.14
156 0.11
157 0.07
158 0.06
159 0.07
160 0.07
161 0.07
162 0.07
163 0.08
164 0.08
165 0.08
166 0.09
167 0.12
168 0.13
169 0.13
170 0.14
171 0.15
172 0.15
173 0.15
174 0.14
175 0.1
176 0.11
177 0.1
178 0.1
179 0.09
180 0.08
181 0.08
182 0.08
183 0.07
184 0.07
185 0.06
186 0.06
187 0.08
188 0.09
189 0.1
190 0.12
191 0.13
192 0.12
193 0.15
194 0.15
195 0.17
196 0.18
197 0.2
198 0.2
199 0.22
200 0.23
201 0.2
202 0.2
203 0.17
204 0.16
205 0.13
206 0.12
207 0.08
208 0.08
209 0.08
210 0.09
211 0.09
212 0.09
213 0.1
214 0.09
215 0.09
216 0.09
217 0.09
218 0.09
219 0.09
220 0.1
221 0.09
222 0.1
223 0.11
224 0.11
225 0.12
226 0.12
227 0.13
228 0.13
229 0.15
230 0.14
231 0.14
232 0.13
233 0.12
234 0.12
235 0.11
236 0.1
237 0.09
238 0.1
239 0.08
240 0.09
241 0.09
242 0.08
243 0.08
244 0.08
245 0.08
246 0.08
247 0.07
248 0.06
249 0.06
250 0.06
251 0.06
252 0.05
253 0.04
254 0.04
255 0.05
256 0.05
257 0.04
258 0.04
259 0.05
260 0.06
261 0.06
262 0.06
263 0.07
264 0.06
265 0.08
266 0.1
267 0.09
268 0.08
269 0.08
270 0.1
271 0.1
272 0.1
273 0.1
274 0.1
275 0.11
276 0.11
277 0.13
278 0.13
279 0.14
280 0.15
281 0.15
282 0.16
283 0.15
284 0.2
285 0.24
286 0.25
287 0.25
288 0.24
289 0.23
290 0.25
291 0.26
292 0.22
293 0.19
294 0.19
295 0.18
296 0.19
297 0.19
298 0.14
299 0.15
300 0.15
301 0.15
302 0.14
303 0.21
304 0.23
305 0.28
306 0.3
307 0.32
308 0.38
309 0.43
310 0.49
311 0.53
312 0.61
313 0.66
314 0.74
315 0.81
316 0.84
317 0.88
318 0.91
319 0.91