Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BTD1

Protein Details
Accession X0BTD1   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-114LHEKHSRKKESHKRDPSKKHSHKKESRKKDSQKEDSHKKSEBasic
146-168QEKLEKLDKKKKELHQEEKELKEBasic
NLS Segment(s)
PositionSequence
65-115KKRVRFKEDLHEKHSRKKESHKRDPSKKHSHKKESRKKDSQKEDSHKKSEP
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MEDNNASGSNTIKKGAAEELPENVAQNMPKLLAKGEPEEGHSESEEEQSQEDDSEEDEPKNDGTKKRVRFKEDLHEKHSRKKESHKRDPSKKHSHKKESRKKDSQKEDSHKKSEPKSSRIDLFDSYTLRRLEGMWNKGFADLKDVQEKLEKLDKKKKELHQEEKELKEWLNRLHESIKNKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.24
4 0.23
5 0.23
6 0.24
7 0.25
8 0.25
9 0.23
10 0.2
11 0.19
12 0.15
13 0.14
14 0.13
15 0.12
16 0.13
17 0.13
18 0.13
19 0.15
20 0.17
21 0.18
22 0.22
23 0.21
24 0.23
25 0.26
26 0.26
27 0.24
28 0.22
29 0.2
30 0.16
31 0.18
32 0.17
33 0.13
34 0.12
35 0.12
36 0.12
37 0.11
38 0.1
39 0.08
40 0.08
41 0.1
42 0.11
43 0.1
44 0.11
45 0.11
46 0.11
47 0.16
48 0.19
49 0.19
50 0.25
51 0.34
52 0.42
53 0.51
54 0.57
55 0.59
56 0.6
57 0.62
58 0.66
59 0.69
60 0.65
61 0.62
62 0.65
63 0.6
64 0.64
65 0.67
66 0.61
67 0.54
68 0.59
69 0.64
70 0.65
71 0.74
72 0.76
73 0.79
74 0.83
75 0.9
76 0.89
77 0.9
78 0.89
79 0.88
80 0.87
81 0.88
82 0.88
83 0.89
84 0.9
85 0.89
86 0.89
87 0.89
88 0.88
89 0.87
90 0.88
91 0.86
92 0.86
93 0.84
94 0.84
95 0.8
96 0.76
97 0.72
98 0.68
99 0.64
100 0.64
101 0.61
102 0.56
103 0.56
104 0.55
105 0.54
106 0.5
107 0.47
108 0.39
109 0.35
110 0.33
111 0.28
112 0.25
113 0.25
114 0.23
115 0.21
116 0.19
117 0.17
118 0.23
119 0.28
120 0.34
121 0.31
122 0.32
123 0.32
124 0.34
125 0.35
126 0.26
127 0.25
128 0.21
129 0.23
130 0.28
131 0.27
132 0.26
133 0.3
134 0.31
135 0.29
136 0.35
137 0.37
138 0.39
139 0.49
140 0.55
141 0.58
142 0.67
143 0.7
144 0.73
145 0.78
146 0.8
147 0.8
148 0.84
149 0.84
150 0.8
151 0.74
152 0.65
153 0.56
154 0.51
155 0.45
156 0.41
157 0.41
158 0.38
159 0.39
160 0.44
161 0.48
162 0.51