Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0BJ44

Protein Details
Accession X0BJ44    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
72-91VGSRKLVKLHKERRKVQKNVBasic
NLS Segment(s)
PositionSequence
75-86RKLVKLHKERRK
Subcellular Location(s) cyto 14.5, cyto_nucl 13.5, nucl 7.5, mito 4
Family & Domain DBs
Amino Acid Sequences MDYTSGPIPLNLVHKPPFTIEAPGYEKVPGETVPRRHPRAKDGLINRPANDIHTVFDIVRRSARVYPNHRAVGSRKLVKLHKERRKVQKNVDGEIKELEKEWQLFELSKFSYLTFKEYEQLVLQVGYGLRKLGLTPKHKLHLFGATRHVSTLVNLHRIALTTSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.29
5 0.26
6 0.28
7 0.24
8 0.27
9 0.3
10 0.3
11 0.29
12 0.25
13 0.24
14 0.2
15 0.21
16 0.16
17 0.18
18 0.23
19 0.28
20 0.38
21 0.46
22 0.52
23 0.57
24 0.59
25 0.6
26 0.63
27 0.63
28 0.62
29 0.6
30 0.64
31 0.66
32 0.65
33 0.58
34 0.5
35 0.45
36 0.38
37 0.34
38 0.24
39 0.17
40 0.16
41 0.16
42 0.13
43 0.16
44 0.16
45 0.14
46 0.15
47 0.15
48 0.16
49 0.2
50 0.26
51 0.31
52 0.36
53 0.43
54 0.48
55 0.5
56 0.47
57 0.45
58 0.41
59 0.41
60 0.4
61 0.37
62 0.32
63 0.34
64 0.37
65 0.42
66 0.5
67 0.52
68 0.56
69 0.6
70 0.67
71 0.73
72 0.8
73 0.79
74 0.77
75 0.74
76 0.69
77 0.63
78 0.62
79 0.51
80 0.42
81 0.38
82 0.3
83 0.22
84 0.19
85 0.17
86 0.12
87 0.12
88 0.11
89 0.11
90 0.11
91 0.12
92 0.12
93 0.14
94 0.12
95 0.13
96 0.13
97 0.13
98 0.16
99 0.15
100 0.18
101 0.17
102 0.17
103 0.18
104 0.18
105 0.19
106 0.16
107 0.16
108 0.13
109 0.11
110 0.1
111 0.09
112 0.09
113 0.09
114 0.08
115 0.08
116 0.07
117 0.07
118 0.08
119 0.14
120 0.22
121 0.26
122 0.33
123 0.39
124 0.46
125 0.47
126 0.5
127 0.45
128 0.47
129 0.45
130 0.43
131 0.45
132 0.41
133 0.4
134 0.38
135 0.36
136 0.27
137 0.24
138 0.28
139 0.25
140 0.27
141 0.26
142 0.27
143 0.26
144 0.27
145 0.27