Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BR46

Protein Details
Accession X0BR46   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-48QLEQEKPVRKTKTKKQKSERRKRRARFEDYDDEBasic
NLS Segment(s)
PositionSequence
21-41KPVRKTKTKKQKSERRKRRAR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSSSSAEQRSDLEEEQLEQEKPVRKTKTKKQKSERRKRRARFEDYDDEQDNSQMAQSNYNAQQQQLQQQQMQQQQQQQMQQQQQQGGGGKSDALSLHLELNLEIEIQLKARIHGDLTLCLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.25
4 0.21
5 0.18
6 0.23
7 0.28
8 0.31
9 0.38
10 0.42
11 0.47
12 0.57
13 0.67
14 0.73
15 0.76
16 0.83
17 0.85
18 0.89
19 0.92
20 0.94
21 0.94
22 0.94
23 0.94
24 0.92
25 0.93
26 0.91
27 0.89
28 0.84
29 0.81
30 0.79
31 0.72
32 0.69
33 0.59
34 0.5
35 0.41
36 0.34
37 0.26
38 0.17
39 0.13
40 0.11
41 0.09
42 0.1
43 0.1
44 0.14
45 0.16
46 0.19
47 0.19
48 0.16
49 0.19
50 0.19
51 0.25
52 0.26
53 0.26
54 0.24
55 0.26
56 0.32
57 0.34
58 0.37
59 0.33
60 0.33
61 0.37
62 0.39
63 0.4
64 0.39
65 0.4
66 0.41
67 0.43
68 0.41
69 0.37
70 0.35
71 0.33
72 0.31
73 0.25
74 0.21
75 0.16
76 0.13
77 0.12
78 0.12
79 0.1
80 0.09
81 0.09
82 0.1
83 0.11
84 0.11
85 0.11
86 0.1
87 0.11
88 0.09
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.11
95 0.1
96 0.11
97 0.13
98 0.14
99 0.14
100 0.17
101 0.19
102 0.18