Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0B6X5

Protein Details
Accession X0B6X5    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
7-58EEVLQKRTKKALRQKRVEEQKQLVLERKRQREEKRERKRRGKETKQLEREANBasic
150-172VAYRDSGRSQRNRKQPRWLDDFEHydrophilic
NLS Segment(s)
PositionSequence
12-54KRTKKALRQKRVEEQKQLVLERKRQREEKRERKRRGKETKQLE
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MEAQKEEEVLQKRTKKALRQKRVEEQKQLVLERKRQREEKRERKRRGKETKQLEREANRQLRIEMKKQNQRSIQPKHQARQNGSDGLEENGGIQDEIIVVLPTVTQPPVLFKPPNEALSTPNTKASTPPSHKTRPKRPSLVVESDREVVVAYRDSGRSQRNRKQPRWLDDFEVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.66
4 0.73
5 0.75
6 0.78
7 0.83
8 0.85
9 0.9
10 0.88
11 0.86
12 0.8
13 0.75
14 0.7
15 0.65
16 0.63
17 0.58
18 0.59
19 0.59
20 0.63
21 0.64
22 0.68
23 0.73
24 0.76
25 0.81
26 0.83
27 0.85
28 0.87
29 0.9
30 0.92
31 0.93
32 0.93
33 0.93
34 0.92
35 0.91
36 0.91
37 0.91
38 0.88
39 0.83
40 0.78
41 0.72
42 0.66
43 0.66
44 0.61
45 0.52
46 0.45
47 0.41
48 0.43
49 0.42
50 0.44
51 0.43
52 0.46
53 0.52
54 0.56
55 0.62
56 0.59
57 0.62
58 0.65
59 0.64
60 0.65
61 0.66
62 0.67
63 0.64
64 0.63
65 0.62
66 0.55
67 0.53
68 0.47
69 0.41
70 0.35
71 0.32
72 0.28
73 0.22
74 0.19
75 0.12
76 0.09
77 0.06
78 0.06
79 0.05
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.04
94 0.08
95 0.11
96 0.15
97 0.16
98 0.16
99 0.23
100 0.26
101 0.28
102 0.27
103 0.25
104 0.23
105 0.29
106 0.33
107 0.27
108 0.28
109 0.27
110 0.25
111 0.27
112 0.31
113 0.34
114 0.36
115 0.43
116 0.46
117 0.55
118 0.64
119 0.72
120 0.76
121 0.75
122 0.79
123 0.79
124 0.78
125 0.78
126 0.77
127 0.77
128 0.7
129 0.64
130 0.58
131 0.51
132 0.45
133 0.35
134 0.27
135 0.18
136 0.15
137 0.13
138 0.11
139 0.13
140 0.14
141 0.17
142 0.23
143 0.31
144 0.39
145 0.48
146 0.56
147 0.64
148 0.73
149 0.78
150 0.83
151 0.84
152 0.83
153 0.82
154 0.78