Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0BT82

Protein Details
Accession X0BT82    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
84-114HDSGKVYTKKHHKCKCPKGEKWHHIEKKCKKBasic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 1, plas 1, extr 1
Family & Domain DBs
Amino Acid Sequences MVSFTTQLSHLSFQHKLITTSQLPTQTFIMLLNKAFLGALLAMGTVTALPNPDAEPADLEDRSILHHCGKHASWDHAKSECVCHDSGKVYTKKHHKCKCPKGEKWHHIEKKCKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.29
4 0.29
5 0.32
6 0.29
7 0.3
8 0.32
9 0.31
10 0.3
11 0.3
12 0.28
13 0.22
14 0.2
15 0.19
16 0.18
17 0.14
18 0.13
19 0.12
20 0.11
21 0.11
22 0.1
23 0.08
24 0.06
25 0.05
26 0.05
27 0.04
28 0.04
29 0.03
30 0.03
31 0.03
32 0.02
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.05
39 0.06
40 0.06
41 0.06
42 0.07
43 0.08
44 0.1
45 0.09
46 0.09
47 0.08
48 0.07
49 0.09
50 0.1
51 0.1
52 0.11
53 0.12
54 0.13
55 0.16
56 0.17
57 0.21
58 0.22
59 0.27
60 0.31
61 0.32
62 0.34
63 0.32
64 0.34
65 0.29
66 0.3
67 0.26
68 0.23
69 0.21
70 0.19
71 0.2
72 0.21
73 0.24
74 0.29
75 0.31
76 0.32
77 0.4
78 0.49
79 0.58
80 0.65
81 0.71
82 0.73
83 0.8
84 0.88
85 0.91
86 0.91
87 0.9
88 0.9
89 0.93
90 0.91
91 0.89
92 0.89
93 0.87
94 0.85