Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0CKC9

Protein Details
Accession X0CKC9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-75HAKATTSTKQSPRKRHPHHGNRETRBasic
NLS Segment(s)
PositionSequence
64-66KRH
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MGKCLSRPERHDNLPKRLYPANTPDNEQPSVYSHPNAMLNPNNAARNTTPHAKATTSTKQSPRKRHPHHGNRETR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.68
3 0.64
4 0.61
5 0.55
6 0.5
7 0.49
8 0.48
9 0.42
10 0.44
11 0.44
12 0.43
13 0.41
14 0.35
15 0.28
16 0.24
17 0.26
18 0.24
19 0.2
20 0.16
21 0.17
22 0.18
23 0.17
24 0.17
25 0.16
26 0.15
27 0.17
28 0.19
29 0.19
30 0.18
31 0.2
32 0.17
33 0.19
34 0.22
35 0.25
36 0.25
37 0.26
38 0.28
39 0.26
40 0.28
41 0.3
42 0.36
43 0.37
44 0.42
45 0.49
46 0.57
47 0.65
48 0.74
49 0.78
50 0.8
51 0.83
52 0.87
53 0.89
54 0.9
55 0.93