Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CNR1

Protein Details
Accession X0CNR1    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-28PLSIPCGWREREKKKHRLDRTSSIDAQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 8.5, mito 7, cyto 6.5, plas 2
Family & Domain DBs
Amino Acid Sequences MPLSIPCGWREREKKKHRLDRTSSIDAQIMDVGDAPSYGSDKMGWSTTALRRSCVWALSDYFAFHSRSRNLWDPFNRARVLFRCFHLIKGFFIQLPFQGCFLCWQRPDASAGLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.82
3 0.9
4 0.9
5 0.91
6 0.88
7 0.87
8 0.85
9 0.82
10 0.73
11 0.63
12 0.55
13 0.44
14 0.37
15 0.27
16 0.19
17 0.11
18 0.1
19 0.09
20 0.06
21 0.06
22 0.05
23 0.05
24 0.06
25 0.06
26 0.05
27 0.05
28 0.06
29 0.08
30 0.08
31 0.08
32 0.09
33 0.13
34 0.17
35 0.24
36 0.24
37 0.24
38 0.24
39 0.27
40 0.27
41 0.23
42 0.2
43 0.14
44 0.15
45 0.15
46 0.15
47 0.12
48 0.12
49 0.13
50 0.14
51 0.13
52 0.17
53 0.17
54 0.19
55 0.24
56 0.3
57 0.3
58 0.35
59 0.39
60 0.42
61 0.44
62 0.47
63 0.43
64 0.36
65 0.39
66 0.35
67 0.36
68 0.31
69 0.29
70 0.32
71 0.32
72 0.34
73 0.35
74 0.32
75 0.3
76 0.32
77 0.32
78 0.24
79 0.25
80 0.23
81 0.19
82 0.22
83 0.2
84 0.17
85 0.15
86 0.15
87 0.2
88 0.23
89 0.28
90 0.25
91 0.28
92 0.29
93 0.31
94 0.34