Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VLW2

Protein Details
Accession A0A0A2VLW2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-64GPEEKQKKPEARRVRKKPQPAVABasic
NLS Segment(s)
PositionSequence
46-59KQKKPEARRVRKKP
Subcellular Location(s) cyto 13.5, cyto_nucl 12.333, nucl 10, mito_nucl 6.333
Family & Domain DBs
KEGG pbl:PAAG_11425  -  
Amino Acid Sequences MMRKEPDAEPTKPSDSTGEALEVSQVVLDDKGAVLGIDATSGPEEKQKKPEARRVRKKPQPAVAPVVMKGEENFQWVDIAPKLENQQRMPPAKKSKKIAQPAGAPAVSVNEGVIPGDQCSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.27
4 0.24
5 0.2
6 0.16
7 0.16
8 0.15
9 0.12
10 0.09
11 0.07
12 0.06
13 0.05
14 0.05
15 0.05
16 0.05
17 0.04
18 0.05
19 0.04
20 0.04
21 0.03
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.06
30 0.11
31 0.15
32 0.17
33 0.24
34 0.31
35 0.39
36 0.45
37 0.55
38 0.6
39 0.68
40 0.76
41 0.8
42 0.83
43 0.82
44 0.86
45 0.83
46 0.79
47 0.74
48 0.67
49 0.62
50 0.54
51 0.48
52 0.39
53 0.33
54 0.25
55 0.19
56 0.15
57 0.12
58 0.1
59 0.1
60 0.1
61 0.09
62 0.09
63 0.09
64 0.11
65 0.09
66 0.11
67 0.09
68 0.11
69 0.15
70 0.19
71 0.24
72 0.24
73 0.3
74 0.36
75 0.43
76 0.45
77 0.5
78 0.57
79 0.63
80 0.68
81 0.69
82 0.71
83 0.73
84 0.79
85 0.78
86 0.73
87 0.7
88 0.67
89 0.65
90 0.56
91 0.46
92 0.36
93 0.3
94 0.24
95 0.18
96 0.13
97 0.08
98 0.08
99 0.08
100 0.1
101 0.08