Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BMY4

Protein Details
Accession X0BMY4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-60VSKSHKVPYSRRQERNPTTNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MAAAPAPKLPLPTSQLSQGYNKQASFLRWIQSTEGIAESVSKSHKVPYSRRQERNPTTNSQQIRTNSSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.32
4 0.35
5 0.35
6 0.37
7 0.36
8 0.34
9 0.31
10 0.3
11 0.29
12 0.31
13 0.28
14 0.24
15 0.22
16 0.23
17 0.22
18 0.21
19 0.2
20 0.15
21 0.13
22 0.1
23 0.08
24 0.08
25 0.07
26 0.07
27 0.08
28 0.08
29 0.08
30 0.12
31 0.17
32 0.22
33 0.3
34 0.38
35 0.49
36 0.58
37 0.66
38 0.7
39 0.77
40 0.8
41 0.82
42 0.77
43 0.73
44 0.69
45 0.69
46 0.65
47 0.57
48 0.55
49 0.5