Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0B1Z9

Protein Details
Accession X0B1Z9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-56VGGIVRRRRSHCRRSRIRQYGRARRTGBasic
NLS Segment(s)
PositionSequence
35-59RRRRSHCRRSRIRQYGRARRTGRRA
Subcellular Location(s) mito 14, nucl 6, cyto 4, extr 3
Family & Domain DBs
Amino Acid Sequences MPLQAHDVASGQHPVAAAIGRGRGAGCQAVGGIVRRRRSHCRRSRIRQYGRARRTGRRAPAWWCRFGDPPDRRAKECDDEKRDHSRLKRDLLYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.09
5 0.08
6 0.1
7 0.09
8 0.09
9 0.09
10 0.08
11 0.09
12 0.09
13 0.08
14 0.07
15 0.06
16 0.07
17 0.07
18 0.1
19 0.15
20 0.19
21 0.24
22 0.27
23 0.32
24 0.42
25 0.51
26 0.59
27 0.62
28 0.69
29 0.74
30 0.81
31 0.87
32 0.88
33 0.86
34 0.85
35 0.86
36 0.86
37 0.8
38 0.8
39 0.73
40 0.68
41 0.69
42 0.67
43 0.63
44 0.59
45 0.58
46 0.56
47 0.62
48 0.61
49 0.57
50 0.51
51 0.47
52 0.45
53 0.45
54 0.48
55 0.42
56 0.45
57 0.51
58 0.52
59 0.52
60 0.51
61 0.54
62 0.53
63 0.57
64 0.6
65 0.57
66 0.59
67 0.63
68 0.68
69 0.68
70 0.66
71 0.64
72 0.64
73 0.64
74 0.67