Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CYG2

Protein Details
Accession X0CYG2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-26GPQLPPHLSKRKRTPDDEASNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022226  DUF3752  
IPR046331  GPAM1-like  
Pfam View protein in Pfam  
PF12572  DUF3752  
Amino Acid Sequences MSSIGPQLPPHLSKRKRTPDDEASNSSKHRRSESPAKNTDEIDLEDSDDDYGPSAPLPPKAPVGPALPASNKDEIDLESDSESDTGPAPPKPTVGPAPPPADISQRPATSPDSDSDSEDDYGPALPGSVKANKPTIGPQLPSAEPAPQRDSWMLAPPTASGYSERDPTKMRNRKFASKPASSSGPSTVSTIWTETPEEKLKRLQDSVLGRADKNTDTAPKLGKSQEEEERNRRIAANIESQRGKSLYAEHQGRREKEGKRVEEEEDDPSKRGFDREKDMALGGKIGTAQRRELMNKAADFGGRFSKGSFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.76
4 0.79
5 0.8
6 0.8
7 0.83
8 0.8
9 0.76
10 0.7
11 0.65
12 0.63
13 0.61
14 0.56
15 0.49
16 0.48
17 0.47
18 0.51
19 0.58
20 0.64
21 0.67
22 0.7
23 0.72
24 0.69
25 0.64
26 0.57
27 0.48
28 0.4
29 0.32
30 0.25
31 0.2
32 0.17
33 0.17
34 0.15
35 0.13
36 0.11
37 0.08
38 0.08
39 0.07
40 0.07
41 0.11
42 0.12
43 0.15
44 0.18
45 0.19
46 0.22
47 0.23
48 0.24
49 0.23
50 0.23
51 0.23
52 0.23
53 0.24
54 0.23
55 0.24
56 0.27
57 0.27
58 0.24
59 0.22
60 0.21
61 0.18
62 0.2
63 0.18
64 0.15
65 0.12
66 0.12
67 0.12
68 0.11
69 0.1
70 0.07
71 0.08
72 0.09
73 0.1
74 0.12
75 0.14
76 0.14
77 0.16
78 0.16
79 0.19
80 0.21
81 0.23
82 0.27
83 0.3
84 0.33
85 0.32
86 0.33
87 0.3
88 0.31
89 0.28
90 0.29
91 0.29
92 0.26
93 0.26
94 0.26
95 0.28
96 0.25
97 0.25
98 0.21
99 0.21
100 0.21
101 0.22
102 0.21
103 0.2
104 0.18
105 0.17
106 0.15
107 0.1
108 0.1
109 0.09
110 0.07
111 0.05
112 0.04
113 0.05
114 0.08
115 0.13
116 0.14
117 0.16
118 0.19
119 0.19
120 0.2
121 0.22
122 0.26
123 0.24
124 0.24
125 0.24
126 0.25
127 0.24
128 0.25
129 0.22
130 0.19
131 0.18
132 0.2
133 0.22
134 0.18
135 0.2
136 0.19
137 0.2
138 0.17
139 0.21
140 0.19
141 0.16
142 0.15
143 0.14
144 0.15
145 0.13
146 0.13
147 0.08
148 0.11
149 0.12
150 0.17
151 0.17
152 0.17
153 0.19
154 0.25
155 0.34
156 0.4
157 0.4
158 0.46
159 0.5
160 0.58
161 0.61
162 0.65
163 0.62
164 0.58
165 0.58
166 0.51
167 0.5
168 0.41
169 0.37
170 0.3
171 0.25
172 0.21
173 0.2
174 0.17
175 0.15
176 0.14
177 0.14
178 0.12
179 0.11
180 0.12
181 0.12
182 0.16
183 0.21
184 0.22
185 0.22
186 0.27
187 0.3
188 0.32
189 0.32
190 0.29
191 0.28
192 0.31
193 0.34
194 0.34
195 0.32
196 0.28
197 0.29
198 0.3
199 0.24
200 0.22
201 0.19
202 0.17
203 0.18
204 0.21
205 0.23
206 0.22
207 0.25
208 0.25
209 0.26
210 0.27
211 0.3
212 0.35
213 0.4
214 0.46
215 0.49
216 0.53
217 0.52
218 0.49
219 0.44
220 0.38
221 0.35
222 0.32
223 0.36
224 0.34
225 0.38
226 0.39
227 0.38
228 0.39
229 0.35
230 0.31
231 0.22
232 0.23
233 0.24
234 0.31
235 0.38
236 0.38
237 0.46
238 0.53
239 0.54
240 0.56
241 0.57
242 0.52
243 0.54
244 0.61
245 0.57
246 0.56
247 0.57
248 0.54
249 0.52
250 0.5
251 0.47
252 0.44
253 0.41
254 0.35
255 0.33
256 0.31
257 0.26
258 0.3
259 0.3
260 0.3
261 0.36
262 0.4
263 0.42
264 0.42
265 0.43
266 0.4
267 0.34
268 0.29
269 0.2
270 0.16
271 0.15
272 0.17
273 0.21
274 0.21
275 0.22
276 0.25
277 0.3
278 0.33
279 0.35
280 0.39
281 0.4
282 0.38
283 0.39
284 0.36
285 0.32
286 0.3
287 0.29
288 0.29
289 0.25
290 0.24