Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0DH09

Protein Details
Accession X0DH09    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-25GSIKSLKRRPTAKSAAKRIGRMFHydrophilic
NLS Segment(s)
PositionSequence
8-23LKRRPTAKSAAKRIGR
259-276SKPIKEQIKPKPKAEVKH
Subcellular Location(s) nucl 15.5, mito_nucl 14, mito 11.5
Family & Domain DBs
Amino Acid Sequences MPGSIKSLKRRPTAKSAAKRIGRMFKRTNSDDPEATSPADSGFSKDSFDSSRVSTSSRFSTSSRMTTKENVEQPRPSVSRYDTAPPKEREVVPPHPFFSSSSEPLLEHGKSVGPGMPVQTEVVIEPGTLPSPVDKESRDEPKLSHTKLEQKPEPVEKSKNIGKTEEALQAVSTPKPAPRPLPEPPTKKTILPEPESPILPRTFREEPKVTPQLMPKFEVKMTQKPEPKVEPKPKSEPAEKMVVPPPTVEDEPEPIVKPSKPIKEQIKPKPKAEVKHSPPKVDHQNVSKAQHKEVQPKMEPKVQPKTQIHKKSTPVQPPHIPEVTQKRSKAPSPEIPATSWASTVPKMPSVTTSSAPRAVSIPNMAPVPAYSVALSTSTIFVPKTAPAPYTARAPTTAPAPMIATAPKVVMSMLGWTLPKPAPIPKRAHSPATSWIVASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.81
4 0.82
5 0.81
6 0.81
7 0.79
8 0.78
9 0.75
10 0.74
11 0.72
12 0.7
13 0.73
14 0.73
15 0.73
16 0.7
17 0.69
18 0.61
19 0.57
20 0.53
21 0.46
22 0.41
23 0.33
24 0.26
25 0.2
26 0.21
27 0.17
28 0.15
29 0.17
30 0.16
31 0.18
32 0.18
33 0.2
34 0.2
35 0.21
36 0.21
37 0.19
38 0.23
39 0.22
40 0.24
41 0.24
42 0.25
43 0.28
44 0.29
45 0.29
46 0.27
47 0.34
48 0.36
49 0.42
50 0.42
51 0.41
52 0.41
53 0.45
54 0.5
55 0.5
56 0.53
57 0.52
58 0.53
59 0.53
60 0.51
61 0.55
62 0.5
63 0.43
64 0.4
65 0.37
66 0.36
67 0.36
68 0.42
69 0.41
70 0.47
71 0.54
72 0.52
73 0.54
74 0.55
75 0.54
76 0.53
77 0.53
78 0.55
79 0.54
80 0.54
81 0.5
82 0.45
83 0.44
84 0.38
85 0.37
86 0.34
87 0.29
88 0.27
89 0.27
90 0.25
91 0.26
92 0.29
93 0.22
94 0.16
95 0.14
96 0.14
97 0.13
98 0.14
99 0.15
100 0.12
101 0.12
102 0.13
103 0.13
104 0.12
105 0.12
106 0.12
107 0.09
108 0.08
109 0.09
110 0.07
111 0.06
112 0.06
113 0.07
114 0.07
115 0.06
116 0.07
117 0.06
118 0.08
119 0.11
120 0.13
121 0.13
122 0.17
123 0.23
124 0.31
125 0.32
126 0.32
127 0.3
128 0.37
129 0.44
130 0.41
131 0.39
132 0.36
133 0.44
134 0.48
135 0.56
136 0.5
137 0.47
138 0.52
139 0.54
140 0.56
141 0.51
142 0.5
143 0.44
144 0.46
145 0.46
146 0.47
147 0.42
148 0.37
149 0.33
150 0.31
151 0.33
152 0.31
153 0.26
154 0.2
155 0.18
156 0.18
157 0.19
158 0.16
159 0.14
160 0.1
161 0.12
162 0.16
163 0.18
164 0.21
165 0.24
166 0.3
167 0.34
168 0.43
169 0.49
170 0.51
171 0.52
172 0.53
173 0.5
174 0.45
175 0.41
176 0.4
177 0.38
178 0.36
179 0.37
180 0.36
181 0.36
182 0.35
183 0.34
184 0.29
185 0.23
186 0.2
187 0.17
188 0.19
189 0.22
190 0.24
191 0.3
192 0.3
193 0.31
194 0.38
195 0.42
196 0.37
197 0.35
198 0.38
199 0.38
200 0.37
201 0.37
202 0.3
203 0.28
204 0.27
205 0.3
206 0.28
207 0.28
208 0.31
209 0.36
210 0.4
211 0.4
212 0.44
213 0.45
214 0.47
215 0.5
216 0.56
217 0.55
218 0.56
219 0.61
220 0.63
221 0.61
222 0.6
223 0.54
224 0.46
225 0.46
226 0.4
227 0.37
228 0.35
229 0.31
230 0.27
231 0.23
232 0.22
233 0.19
234 0.19
235 0.16
236 0.13
237 0.13
238 0.15
239 0.16
240 0.15
241 0.12
242 0.15
243 0.14
244 0.19
245 0.23
246 0.29
247 0.3
248 0.38
249 0.46
250 0.52
251 0.62
252 0.67
253 0.71
254 0.69
255 0.68
256 0.7
257 0.66
258 0.64
259 0.62
260 0.62
261 0.59
262 0.65
263 0.66
264 0.6
265 0.57
266 0.59
267 0.6
268 0.55
269 0.52
270 0.47
271 0.53
272 0.54
273 0.56
274 0.56
275 0.48
276 0.45
277 0.46
278 0.46
279 0.46
280 0.47
281 0.5
282 0.48
283 0.52
284 0.54
285 0.55
286 0.55
287 0.52
288 0.57
289 0.52
290 0.56
291 0.57
292 0.64
293 0.66
294 0.72
295 0.72
296 0.69
297 0.71
298 0.71
299 0.73
300 0.73
301 0.69
302 0.66
303 0.66
304 0.64
305 0.64
306 0.56
307 0.48
308 0.45
309 0.49
310 0.5
311 0.5
312 0.47
313 0.47
314 0.5
315 0.54
316 0.55
317 0.53
318 0.53
319 0.55
320 0.59
321 0.55
322 0.51
323 0.5
324 0.45
325 0.37
326 0.29
327 0.22
328 0.19
329 0.17
330 0.2
331 0.19
332 0.2
333 0.2
334 0.2
335 0.22
336 0.25
337 0.28
338 0.27
339 0.3
340 0.29
341 0.32
342 0.32
343 0.29
344 0.26
345 0.24
346 0.23
347 0.22
348 0.2
349 0.18
350 0.19
351 0.18
352 0.16
353 0.15
354 0.17
355 0.14
356 0.14
357 0.11
358 0.11
359 0.12
360 0.12
361 0.13
362 0.09
363 0.1
364 0.09
365 0.11
366 0.11
367 0.11
368 0.12
369 0.13
370 0.15
371 0.16
372 0.17
373 0.19
374 0.24
375 0.25
376 0.31
377 0.31
378 0.29
379 0.29
380 0.3
381 0.28
382 0.27
383 0.27
384 0.2
385 0.19
386 0.19
387 0.18
388 0.18
389 0.17
390 0.16
391 0.14
392 0.14
393 0.13
394 0.12
395 0.11
396 0.1
397 0.09
398 0.1
399 0.1
400 0.12
401 0.13
402 0.13
403 0.18
404 0.18
405 0.2
406 0.2
407 0.29
408 0.35
409 0.43
410 0.5
411 0.5
412 0.6
413 0.63
414 0.68
415 0.62
416 0.57
417 0.58
418 0.57
419 0.52