Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1H7W5

Protein Details
Accession C1H7W5    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
247-266DEDYRQPRPTTRRPNYAHVRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 9, cyto_nucl 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
KEGG pbl:PAAG_06856  -  
Amino Acid Sequences MAAVQLSFSIRTSPNVKTIHLLGSWDNYTGQLPLSQDASAKTGSWKGTFRFQGNSLQLGQRYWYYYIMDGYHVSHDPTAEYTVEPTTGRKLNILDVPCGARSSNNSSSNRHSSDGVIKGRALSPSKILSPKPSKPYASRQIRDARYSPPPTVSELTRRFGNVDMSDSDSDISTSPPSSTGSSMSGRSDNSSPSSISSLSDNSSVCSCERYGITRKGDRVKLDCGGSRCGANSPGSDSNYCSSDDSEDEDYRQPRPTTRRPNYAHVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.34
4 0.33
5 0.34
6 0.33
7 0.3
8 0.29
9 0.22
10 0.25
11 0.25
12 0.22
13 0.2
14 0.17
15 0.17
16 0.15
17 0.14
18 0.12
19 0.12
20 0.13
21 0.14
22 0.13
23 0.14
24 0.15
25 0.16
26 0.14
27 0.14
28 0.15
29 0.17
30 0.2
31 0.22
32 0.25
33 0.25
34 0.33
35 0.37
36 0.37
37 0.37
38 0.37
39 0.42
40 0.41
41 0.41
42 0.35
43 0.33
44 0.31
45 0.27
46 0.26
47 0.2
48 0.2
49 0.19
50 0.18
51 0.16
52 0.16
53 0.18
54 0.17
55 0.17
56 0.15
57 0.14
58 0.15
59 0.14
60 0.14
61 0.12
62 0.12
63 0.11
64 0.12
65 0.12
66 0.1
67 0.09
68 0.1
69 0.1
70 0.11
71 0.11
72 0.1
73 0.13
74 0.16
75 0.16
76 0.16
77 0.17
78 0.19
79 0.24
80 0.24
81 0.21
82 0.19
83 0.2
84 0.19
85 0.19
86 0.15
87 0.11
88 0.13
89 0.2
90 0.26
91 0.32
92 0.34
93 0.37
94 0.43
95 0.47
96 0.47
97 0.4
98 0.33
99 0.27
100 0.3
101 0.34
102 0.3
103 0.25
104 0.22
105 0.22
106 0.22
107 0.24
108 0.2
109 0.14
110 0.15
111 0.16
112 0.18
113 0.21
114 0.2
115 0.25
116 0.3
117 0.35
118 0.38
119 0.4
120 0.41
121 0.42
122 0.5
123 0.52
124 0.55
125 0.51
126 0.51
127 0.56
128 0.56
129 0.55
130 0.49
131 0.42
132 0.41
133 0.43
134 0.37
135 0.31
136 0.29
137 0.29
138 0.29
139 0.27
140 0.27
141 0.28
142 0.29
143 0.27
144 0.27
145 0.24
146 0.24
147 0.26
148 0.18
149 0.17
150 0.15
151 0.18
152 0.18
153 0.17
154 0.16
155 0.12
156 0.12
157 0.1
158 0.09
159 0.07
160 0.07
161 0.07
162 0.08
163 0.09
164 0.1
165 0.11
166 0.12
167 0.14
168 0.15
169 0.16
170 0.17
171 0.17
172 0.17
173 0.19
174 0.18
175 0.17
176 0.18
177 0.19
178 0.17
179 0.17
180 0.18
181 0.16
182 0.15
183 0.15
184 0.14
185 0.14
186 0.16
187 0.14
188 0.14
189 0.14
190 0.15
191 0.13
192 0.14
193 0.13
194 0.13
195 0.14
196 0.19
197 0.25
198 0.32
199 0.39
200 0.42
201 0.49
202 0.54
203 0.58
204 0.58
205 0.55
206 0.52
207 0.49
208 0.48
209 0.46
210 0.41
211 0.4
212 0.35
213 0.32
214 0.28
215 0.26
216 0.25
217 0.22
218 0.2
219 0.23
220 0.26
221 0.28
222 0.28
223 0.29
224 0.29
225 0.28
226 0.28
227 0.23
228 0.19
229 0.19
230 0.19
231 0.21
232 0.24
233 0.24
234 0.25
235 0.3
236 0.31
237 0.31
238 0.37
239 0.34
240 0.37
241 0.45
242 0.53
243 0.58
244 0.66
245 0.74
246 0.73