Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0D4T4

Protein Details
Accession X0D4T4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MFSRLFRRLRPARFRRAPPPRRIAPHydrophilic
NLS Segment(s)
PositionSequence
7-23RRLRPARFRRAPPPRRI
Subcellular Location(s) mito 18.5, mito_nucl 12, nucl 4.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MFSRLFRRLRPARFRRAPPPRRIAPPADAQLGGKYPSPEQMNRYIYDTAMAWNAADAQIPWITRMLRKPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.84
4 0.84
5 0.82
6 0.82
7 0.77
8 0.75
9 0.73
10 0.66
11 0.59
12 0.55
13 0.49
14 0.42
15 0.36
16 0.29
17 0.25
18 0.22
19 0.19
20 0.13
21 0.11
22 0.1
23 0.13
24 0.16
25 0.17
26 0.19
27 0.26
28 0.27
29 0.27
30 0.3
31 0.27
32 0.24
33 0.23
34 0.21
35 0.14
36 0.12
37 0.11
38 0.08
39 0.07
40 0.08
41 0.07
42 0.07
43 0.06
44 0.07
45 0.1
46 0.1
47 0.11
48 0.14
49 0.15
50 0.2