Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CPU0

Protein Details
Accession X0CPU0   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MPKTRRERRESPPRPKKTARLTCKNCRARKVRCBasic
NLS Segment(s)
PositionSequence
4-18TRRERRESPPRPKKT
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPKTRRERRESPPRPKKTARLTCKNCRARKVRCDGGQPICGICIAYNETCQYDRPPPMTQIRAMADKIAQLEQTIKDLQNKDGTSTAPLQASAAVLAKLRNRSTNRFDRFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.84
5 0.84
6 0.83
7 0.83
8 0.83
9 0.85
10 0.88
11 0.89
12 0.84
13 0.82
14 0.81
15 0.79
16 0.8
17 0.78
18 0.76
19 0.71
20 0.72
21 0.69
22 0.65
23 0.59
24 0.5
25 0.41
26 0.32
27 0.27
28 0.2
29 0.13
30 0.09
31 0.09
32 0.09
33 0.1
34 0.1
35 0.12
36 0.12
37 0.13
38 0.14
39 0.16
40 0.18
41 0.2
42 0.21
43 0.24
44 0.27
45 0.28
46 0.26
47 0.25
48 0.25
49 0.24
50 0.23
51 0.19
52 0.15
53 0.14
54 0.15
55 0.12
56 0.1
57 0.08
58 0.1
59 0.1
60 0.13
61 0.13
62 0.14
63 0.19
64 0.2
65 0.23
66 0.27
67 0.27
68 0.26
69 0.26
70 0.25
71 0.23
72 0.24
73 0.23
74 0.17
75 0.17
76 0.15
77 0.14
78 0.13
79 0.11
80 0.1
81 0.08
82 0.09
83 0.12
84 0.16
85 0.22
86 0.25
87 0.32
88 0.37
89 0.44
90 0.53
91 0.61