Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BPU1

Protein Details
Accession X0BPU1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-48LGARDKPKCYYKDKHCCNFKDDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17.5, cyto_nucl 9.5, extr 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039448  Beta_helix  
IPR012334  Pectin_lyas_fold  
IPR011050  Pectin_lyase_fold/virulence  
Pfam View protein in Pfam  
PF13229  Beta_helix  
Amino Acid Sequences MKITSALTGILFLGSVAASPLSDEEGLGARDKPKCYYKDKHCCNFKDDYTPEYGNSGQYGHRHTIYVRHDESIQKAINKASRGDTIVVAAGTYAEQLTISKDGIKLIGKGAVLVPPKKIVNNMCSGLSGPKTEAGICVQGKGIELDKFVIEHRKVLSVKRPVKDVSIIGFEVRKFSGINIAVLGAMNTRVSKNILADGAKYGTLTAGSTKTAVEGNRVLHTGLGVNGIGICMDNFSDVHVEKNMVTDYGVGICVQTNGADVHHNMVSQSCFGIYVDPGVTGAKVRHNHVGPINPACQIAWGITIDGAAGSKVSDNLVEGQKNKGASVGLVVIDEECSPTSPLFGLSCVTLKRKFIALDNIFLRNTFRDNDLDVFVNTTSKSNIFKCDSCKTSSPKGLCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.06
8 0.08
9 0.08
10 0.08
11 0.09
12 0.11
13 0.12
14 0.14
15 0.16
16 0.19
17 0.25
18 0.27
19 0.32
20 0.37
21 0.43
22 0.5
23 0.58
24 0.64
25 0.7
26 0.78
27 0.82
28 0.84
29 0.82
30 0.78
31 0.76
32 0.68
33 0.67
34 0.59
35 0.53
36 0.5
37 0.47
38 0.42
39 0.37
40 0.34
41 0.25
42 0.23
43 0.21
44 0.17
45 0.2
46 0.24
47 0.25
48 0.25
49 0.25
50 0.25
51 0.32
52 0.35
53 0.39
54 0.36
55 0.34
56 0.36
57 0.38
58 0.41
59 0.4
60 0.37
61 0.3
62 0.31
63 0.34
64 0.35
65 0.34
66 0.33
67 0.3
68 0.29
69 0.3
70 0.29
71 0.25
72 0.21
73 0.2
74 0.17
75 0.13
76 0.1
77 0.08
78 0.06
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.07
85 0.08
86 0.08
87 0.1
88 0.1
89 0.11
90 0.14
91 0.15
92 0.14
93 0.13
94 0.16
95 0.14
96 0.14
97 0.14
98 0.16
99 0.19
100 0.2
101 0.2
102 0.2
103 0.22
104 0.22
105 0.26
106 0.26
107 0.26
108 0.3
109 0.3
110 0.27
111 0.27
112 0.27
113 0.24
114 0.21
115 0.18
116 0.13
117 0.13
118 0.13
119 0.13
120 0.13
121 0.12
122 0.16
123 0.15
124 0.15
125 0.14
126 0.14
127 0.14
128 0.14
129 0.15
130 0.1
131 0.1
132 0.1
133 0.1
134 0.1
135 0.11
136 0.17
137 0.16
138 0.17
139 0.18
140 0.23
141 0.24
142 0.27
143 0.34
144 0.37
145 0.44
146 0.43
147 0.45
148 0.4
149 0.41
150 0.4
151 0.33
152 0.25
153 0.21
154 0.2
155 0.17
156 0.17
157 0.15
158 0.14
159 0.13
160 0.11
161 0.09
162 0.09
163 0.14
164 0.13
165 0.13
166 0.12
167 0.12
168 0.11
169 0.11
170 0.11
171 0.05
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.07
178 0.08
179 0.08
180 0.09
181 0.1
182 0.1
183 0.1
184 0.11
185 0.1
186 0.09
187 0.09
188 0.07
189 0.06
190 0.05
191 0.05
192 0.05
193 0.06
194 0.06
195 0.06
196 0.06
197 0.07
198 0.09
199 0.09
200 0.1
201 0.12
202 0.13
203 0.14
204 0.15
205 0.14
206 0.12
207 0.12
208 0.09
209 0.07
210 0.07
211 0.05
212 0.05
213 0.05
214 0.05
215 0.04
216 0.04
217 0.03
218 0.03
219 0.03
220 0.04
221 0.03
222 0.04
223 0.07
224 0.07
225 0.08
226 0.09
227 0.09
228 0.09
229 0.11
230 0.1
231 0.08
232 0.08
233 0.07
234 0.07
235 0.07
236 0.07
237 0.05
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.06
246 0.08
247 0.08
248 0.1
249 0.11
250 0.11
251 0.1
252 0.11
253 0.11
254 0.1
255 0.1
256 0.07
257 0.07
258 0.07
259 0.08
260 0.07
261 0.08
262 0.08
263 0.07
264 0.08
265 0.07
266 0.07
267 0.08
268 0.09
269 0.14
270 0.16
271 0.19
272 0.26
273 0.27
274 0.31
275 0.33
276 0.37
277 0.35
278 0.37
279 0.35
280 0.3
281 0.29
282 0.24
283 0.21
284 0.16
285 0.13
286 0.1
287 0.09
288 0.08
289 0.08
290 0.08
291 0.07
292 0.06
293 0.06
294 0.04
295 0.04
296 0.04
297 0.04
298 0.05
299 0.05
300 0.06
301 0.07
302 0.11
303 0.16
304 0.19
305 0.2
306 0.23
307 0.25
308 0.25
309 0.24
310 0.21
311 0.17
312 0.14
313 0.14
314 0.13
315 0.11
316 0.1
317 0.1
318 0.09
319 0.09
320 0.09
321 0.08
322 0.07
323 0.08
324 0.09
325 0.09
326 0.1
327 0.1
328 0.11
329 0.11
330 0.11
331 0.11
332 0.11
333 0.14
334 0.17
335 0.22
336 0.23
337 0.25
338 0.27
339 0.3
340 0.3
341 0.33
342 0.4
343 0.38
344 0.42
345 0.43
346 0.45
347 0.41
348 0.39
349 0.36
350 0.27
351 0.28
352 0.22
353 0.22
354 0.21
355 0.24
356 0.27
357 0.27
358 0.27
359 0.24
360 0.24
361 0.21
362 0.2
363 0.18
364 0.17
365 0.16
366 0.17
367 0.23
368 0.23
369 0.31
370 0.34
371 0.38
372 0.43
373 0.5
374 0.51
375 0.52
376 0.57
377 0.56
378 0.6
379 0.65