Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BDR0

Protein Details
Accession X0BDR0   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
236-273DRDERRSQSRGRSRSRSRSRSRSRSRSRSRSRSRSRSPBasic
NLS Segment(s)
PositionSequence
146-152RKLRRRG
241-273RSQSRGRSRSRSRSRSRSRSRSRSRSRSRSRSP
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005037  PRP38  
Gene Ontology GO:0071011  C:precatalytic spliceosome  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF03371  PRP38  
Amino Acid Sequences MSRNKDTVHADARRFLDERGSNVSVAPNGLNPATIMEKAVKDRIVDSYFYKEQCFALNEADIVDRVVEHVNFIGGTYGVTQKPSPFLCLAFKLLELSPSDAVLMEYLKYGGEAFKYLRALACFYFRLTRQAKDVYEMLEPFLEDRRKLRRRGRAGVVLTFMDEFVDELLTKERVCGTSLWKMPKREVLEDLEILEPRVSPLGDLEDLLEEEDEAEKENGTREESGEISDRDDMEVDRDERRSQSRGRSRSRSRSRSRSRSRSRSRSRSRSRSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.4
3 0.4
4 0.35
5 0.36
6 0.37
7 0.36
8 0.32
9 0.32
10 0.33
11 0.24
12 0.23
13 0.2
14 0.13
15 0.14
16 0.13
17 0.13
18 0.11
19 0.12
20 0.13
21 0.13
22 0.13
23 0.14
24 0.17
25 0.2
26 0.23
27 0.22
28 0.21
29 0.22
30 0.27
31 0.26
32 0.26
33 0.25
34 0.29
35 0.32
36 0.32
37 0.32
38 0.27
39 0.25
40 0.27
41 0.27
42 0.21
43 0.19
44 0.18
45 0.17
46 0.17
47 0.16
48 0.13
49 0.1
50 0.08
51 0.06
52 0.07
53 0.09
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.05
62 0.05
63 0.06
64 0.1
65 0.1
66 0.11
67 0.12
68 0.12
69 0.17
70 0.17
71 0.19
72 0.16
73 0.18
74 0.19
75 0.2
76 0.22
77 0.18
78 0.17
79 0.17
80 0.16
81 0.16
82 0.14
83 0.14
84 0.12
85 0.11
86 0.11
87 0.09
88 0.09
89 0.08
90 0.07
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.07
101 0.09
102 0.1
103 0.1
104 0.11
105 0.11
106 0.13
107 0.12
108 0.14
109 0.12
110 0.12
111 0.15
112 0.14
113 0.21
114 0.22
115 0.23
116 0.23
117 0.26
118 0.26
119 0.26
120 0.26
121 0.2
122 0.19
123 0.18
124 0.15
125 0.11
126 0.1
127 0.08
128 0.12
129 0.12
130 0.11
131 0.15
132 0.25
133 0.31
134 0.39
135 0.47
136 0.52
137 0.59
138 0.66
139 0.68
140 0.65
141 0.62
142 0.55
143 0.49
144 0.39
145 0.31
146 0.24
147 0.18
148 0.1
149 0.07
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.06
156 0.07
157 0.07
158 0.08
159 0.09
160 0.09
161 0.11
162 0.11
163 0.14
164 0.21
165 0.26
166 0.34
167 0.38
168 0.4
169 0.41
170 0.46
171 0.46
172 0.41
173 0.4
174 0.36
175 0.34
176 0.32
177 0.32
178 0.26
179 0.22
180 0.2
181 0.17
182 0.11
183 0.09
184 0.1
185 0.08
186 0.06
187 0.07
188 0.1
189 0.1
190 0.1
191 0.1
192 0.09
193 0.1
194 0.1
195 0.09
196 0.05
197 0.06
198 0.07
199 0.06
200 0.08
201 0.08
202 0.08
203 0.08
204 0.11
205 0.12
206 0.13
207 0.14
208 0.13
209 0.15
210 0.15
211 0.17
212 0.18
213 0.18
214 0.17
215 0.19
216 0.18
217 0.16
218 0.17
219 0.15
220 0.14
221 0.18
222 0.18
223 0.2
224 0.22
225 0.24
226 0.27
227 0.32
228 0.34
229 0.36
230 0.45
231 0.52
232 0.59
233 0.66
234 0.72
235 0.78
236 0.84
237 0.89
238 0.89
239 0.89
240 0.9
241 0.92
242 0.92
243 0.93
244 0.93
245 0.93
246 0.94
247 0.95
248 0.95
249 0.95
250 0.95
251 0.95
252 0.95
253 0.95