Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0C978

Protein Details
Accession X0C978    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-48IEKPSDDSIHKKKRHKASCKERYFNTHydrophilic
NLS Segment(s)
PositionSequence
35-35K
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MGTLIRESQVNKSKLISDWLLKIEKPSDDSIHKKKRHKASCKERYFNTEYPCQRIPTTSNSSHDNQLVANPTPQNLQDASKPMPRKHARSITEMVGSDEEGDAIDDTPKASSRGWRKKALDLSRAQRHLMPLLPQPRVLHHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.33
4 0.27
5 0.29
6 0.32
7 0.33
8 0.3
9 0.31
10 0.29
11 0.27
12 0.27
13 0.26
14 0.26
15 0.3
16 0.39
17 0.46
18 0.53
19 0.6
20 0.65
21 0.7
22 0.77
23 0.81
24 0.83
25 0.83
26 0.84
27 0.87
28 0.89
29 0.86
30 0.78
31 0.75
32 0.72
33 0.66
34 0.58
35 0.56
36 0.48
37 0.48
38 0.47
39 0.41
40 0.34
41 0.31
42 0.3
43 0.28
44 0.33
45 0.31
46 0.31
47 0.33
48 0.34
49 0.34
50 0.32
51 0.25
52 0.18
53 0.17
54 0.17
55 0.14
56 0.14
57 0.12
58 0.12
59 0.13
60 0.13
61 0.12
62 0.1
63 0.11
64 0.11
65 0.15
66 0.17
67 0.22
68 0.25
69 0.25
70 0.34
71 0.38
72 0.42
73 0.47
74 0.53
75 0.51
76 0.53
77 0.55
78 0.47
79 0.45
80 0.4
81 0.32
82 0.24
83 0.2
84 0.15
85 0.12
86 0.09
87 0.06
88 0.06
89 0.05
90 0.05
91 0.06
92 0.05
93 0.06
94 0.07
95 0.08
96 0.09
97 0.1
98 0.18
99 0.28
100 0.39
101 0.45
102 0.54
103 0.56
104 0.63
105 0.72
106 0.72
107 0.69
108 0.67
109 0.7
110 0.71
111 0.7
112 0.63
113 0.55
114 0.5
115 0.45
116 0.4
117 0.35
118 0.34
119 0.39
120 0.39
121 0.4
122 0.38