Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0E1L0

Protein Details
Accession X0E1L0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
161-193GTSIRGDGRRERKERIKRNERKMRKNQAQGTGKBasic
NLS Segment(s)
PositionSequence
87-117REKPVPQAKPPTKWERFAAKKGIKPKTREQR
156-188KKRKEGTSIRGDGRRERKERIKRNERKMRKNQA
Subcellular Location(s) nucl 17.5, mito_nucl 13.166, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MALPSSKPKLPVAVEKPTPYTFDLGHLLAEDPNPVTLDRDNLEQSLAELARDGAQSLINQFLSTCPLNSTAEGVLLTLPAPSTRLPREKPVPQAKPPTKWERFAAKKGIKPKTREQRRNLAFDEQTGEWQRKWGYKALNKKGEDWPIVEVDMEAEKKRKEGTSIRGDGRRERKERIKRNERKMRKNQAQGTGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.55
4 0.49
5 0.48
6 0.39
7 0.35
8 0.26
9 0.25
10 0.25
11 0.2
12 0.19
13 0.17
14 0.16
15 0.15
16 0.14
17 0.12
18 0.09
19 0.09
20 0.1
21 0.1
22 0.11
23 0.11
24 0.14
25 0.14
26 0.17
27 0.17
28 0.16
29 0.17
30 0.14
31 0.14
32 0.15
33 0.14
34 0.1
35 0.09
36 0.1
37 0.11
38 0.11
39 0.11
40 0.07
41 0.08
42 0.08
43 0.09
44 0.11
45 0.09
46 0.09
47 0.09
48 0.09
49 0.12
50 0.12
51 0.11
52 0.1
53 0.12
54 0.13
55 0.13
56 0.14
57 0.11
58 0.11
59 0.1
60 0.09
61 0.07
62 0.06
63 0.06
64 0.04
65 0.04
66 0.03
67 0.05
68 0.06
69 0.09
70 0.14
71 0.2
72 0.22
73 0.28
74 0.35
75 0.38
76 0.47
77 0.53
78 0.54
79 0.54
80 0.62
81 0.6
82 0.6
83 0.62
84 0.62
85 0.55
86 0.52
87 0.51
88 0.5
89 0.51
90 0.5
91 0.53
92 0.48
93 0.49
94 0.55
95 0.61
96 0.57
97 0.57
98 0.62
99 0.63
100 0.7
101 0.75
102 0.72
103 0.73
104 0.72
105 0.73
106 0.66
107 0.61
108 0.5
109 0.42
110 0.4
111 0.29
112 0.29
113 0.26
114 0.25
115 0.18
116 0.21
117 0.22
118 0.22
119 0.24
120 0.25
121 0.31
122 0.37
123 0.48
124 0.55
125 0.61
126 0.59
127 0.61
128 0.62
129 0.59
130 0.54
131 0.44
132 0.37
133 0.29
134 0.28
135 0.24
136 0.17
137 0.12
138 0.13
139 0.13
140 0.13
141 0.16
142 0.16
143 0.18
144 0.21
145 0.21
146 0.25
147 0.31
148 0.38
149 0.45
150 0.51
151 0.56
152 0.58
153 0.6
154 0.63
155 0.65
156 0.66
157 0.61
158 0.63
159 0.67
160 0.73
161 0.8
162 0.82
163 0.84
164 0.84
165 0.91
166 0.93
167 0.93
168 0.94
169 0.94
170 0.94
171 0.93
172 0.93
173 0.9