Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BDG5

Protein Details
Accession X0BDG5   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MVHSKTNAKSDQRRKRAKQKPLDNVRTRVGHydrophilic
NLS Segment(s)
PositionSequence
13-19RRKRAKQ
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVHSKTNAKSDQRRKRAKQKPLDNVRTRVGSCKGKVTDVYIRFTTYPKWRFERYDHKVVKWGDFKLIGKYENIKSIEEVARVAREYIENKLARMRLEEEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.89
3 0.9
4 0.9
5 0.9
6 0.89
7 0.9
8 0.9
9 0.91
10 0.87
11 0.82
12 0.75
13 0.68
14 0.58
15 0.53
16 0.48
17 0.44
18 0.38
19 0.41
20 0.38
21 0.36
22 0.36
23 0.35
24 0.36
25 0.32
26 0.35
27 0.28
28 0.28
29 0.27
30 0.27
31 0.27
32 0.27
33 0.3
34 0.3
35 0.34
36 0.36
37 0.39
38 0.44
39 0.51
40 0.49
41 0.54
42 0.52
43 0.48
44 0.52
45 0.5
46 0.5
47 0.43
48 0.37
49 0.29
50 0.3
51 0.3
52 0.28
53 0.29
54 0.24
55 0.21
56 0.26
57 0.25
58 0.28
59 0.29
60 0.25
61 0.23
62 0.28
63 0.29
64 0.24
65 0.24
66 0.19
67 0.19
68 0.19
69 0.18
70 0.14
71 0.16
72 0.17
73 0.21
74 0.27
75 0.26
76 0.27
77 0.32
78 0.33
79 0.31
80 0.33