Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CW72

Protein Details
Accession X0CW72   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-111CSLCNTREPIWKRRKRKEDGRDTKRRGDTDBasic
NLS Segment(s)
PositionSequence
92-107WKRRKRKEDGRDTKRR
Subcellular Location(s) cyto_nucl 14, cyto 13.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Pfam View protein in Pfam  
PF00856  SET  
Amino Acid Sequences MNATESVCLDKFKRDCAFQDPSGTRVLIYSLVSNINHACLDCAQATFLVAEAYDITVTLVKDVRAGEEIFIDFGEARSHFDCSLCNTREPIWKRRKRKEDGRDTKRRGDTDGEEPQNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.43
4 0.48
5 0.42
6 0.5
7 0.43
8 0.4
9 0.39
10 0.35
11 0.28
12 0.21
13 0.2
14 0.12
15 0.12
16 0.11
17 0.1
18 0.12
19 0.12
20 0.13
21 0.12
22 0.12
23 0.12
24 0.11
25 0.1
26 0.08
27 0.1
28 0.09
29 0.09
30 0.08
31 0.08
32 0.08
33 0.07
34 0.07
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.08
49 0.08
50 0.08
51 0.09
52 0.09
53 0.08
54 0.08
55 0.09
56 0.07
57 0.07
58 0.07
59 0.05
60 0.05
61 0.07
62 0.06
63 0.09
64 0.09
65 0.11
66 0.11
67 0.11
68 0.12
69 0.17
70 0.25
71 0.25
72 0.25
73 0.26
74 0.29
75 0.38
76 0.42
77 0.47
78 0.49
79 0.57
80 0.67
81 0.76
82 0.83
83 0.84
84 0.89
85 0.9
86 0.9
87 0.92
88 0.92
89 0.92
90 0.89
91 0.88
92 0.85
93 0.75
94 0.68
95 0.63
96 0.58
97 0.55
98 0.59