Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BDM7

Protein Details
Accession X0BDM7   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
315-335LPPWKLPDRYKQQEQEQKETTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 4, pero 3, nucl 2.5, cyto_nucl 2.5, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000028  Chloroperoxidase  
IPR036851  Chloroperoxidase-like_sf  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004601  F:peroxidase activity  
Pfam View protein in Pfam  
PF01328  Peroxidase_2  
PROSITE View protein in PROSITE  
PS51405  HEME_HALOPEROXIDASE  
Amino Acid Sequences MSPTINLLLLFVASSSFAFTFASPLSNHPTFGAQEQKAIGHNDLFIPSPHNPVPYKEPFEWDEKIHYYEKHTNGSGHGYYRRSSCPGVNTLANRGFINRSGRNISYDEIAQAARVVWNFGDDNIEIVLGPTRKEHPGPRIDLDMFADDAVQFKINCLAAPTRDDRRVGDNVNLNKTLLKQLLSASKDGETLTIEDTAEHHHRRHNDSKATNPNFRFGNSGAICSLAQYANMFGMLGRQGKNGPGTLHVEDVKKFYLDEDWPKDYWRRQLPYYSPEANSYIDRMARHIGYQIERPYPPDDHNLYDVEGDVAVFDVLPPWKLPDRYKQQEQEQKETTYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.08
4 0.08
5 0.09
6 0.09
7 0.11
8 0.11
9 0.14
10 0.13
11 0.16
12 0.23
13 0.23
14 0.24
15 0.22
16 0.25
17 0.23
18 0.27
19 0.33
20 0.26
21 0.28
22 0.28
23 0.29
24 0.29
25 0.31
26 0.28
27 0.2
28 0.2
29 0.19
30 0.19
31 0.18
32 0.15
33 0.18
34 0.17
35 0.22
36 0.23
37 0.26
38 0.27
39 0.3
40 0.37
41 0.4
42 0.45
43 0.4
44 0.44
45 0.41
46 0.46
47 0.44
48 0.38
49 0.36
50 0.32
51 0.35
52 0.33
53 0.32
54 0.34
55 0.4
56 0.42
57 0.41
58 0.4
59 0.37
60 0.36
61 0.4
62 0.34
63 0.3
64 0.31
65 0.29
66 0.29
67 0.31
68 0.33
69 0.31
70 0.31
71 0.3
72 0.29
73 0.31
74 0.32
75 0.33
76 0.32
77 0.34
78 0.35
79 0.33
80 0.28
81 0.26
82 0.24
83 0.24
84 0.3
85 0.26
86 0.27
87 0.3
88 0.31
89 0.32
90 0.32
91 0.28
92 0.23
93 0.21
94 0.17
95 0.14
96 0.13
97 0.1
98 0.09
99 0.08
100 0.07
101 0.07
102 0.07
103 0.06
104 0.08
105 0.08
106 0.08
107 0.1
108 0.09
109 0.09
110 0.09
111 0.09
112 0.06
113 0.07
114 0.09
115 0.08
116 0.08
117 0.09
118 0.12
119 0.14
120 0.17
121 0.21
122 0.25
123 0.31
124 0.34
125 0.34
126 0.36
127 0.34
128 0.32
129 0.29
130 0.23
131 0.17
132 0.13
133 0.11
134 0.07
135 0.07
136 0.07
137 0.07
138 0.06
139 0.06
140 0.09
141 0.09
142 0.09
143 0.09
144 0.1
145 0.1
146 0.13
147 0.17
148 0.18
149 0.21
150 0.22
151 0.21
152 0.24
153 0.26
154 0.24
155 0.25
156 0.27
157 0.28
158 0.3
159 0.29
160 0.25
161 0.22
162 0.22
163 0.21
164 0.16
165 0.13
166 0.11
167 0.13
168 0.19
169 0.19
170 0.19
171 0.17
172 0.16
173 0.16
174 0.16
175 0.14
176 0.09
177 0.08
178 0.09
179 0.08
180 0.08
181 0.07
182 0.08
183 0.11
184 0.16
185 0.17
186 0.18
187 0.21
188 0.25
189 0.33
190 0.4
191 0.44
192 0.47
193 0.48
194 0.55
195 0.62
196 0.63
197 0.63
198 0.56
199 0.53
200 0.45
201 0.43
202 0.37
203 0.27
204 0.31
205 0.24
206 0.24
207 0.2
208 0.21
209 0.2
210 0.17
211 0.18
212 0.09
213 0.09
214 0.08
215 0.08
216 0.07
217 0.07
218 0.06
219 0.04
220 0.06
221 0.08
222 0.11
223 0.11
224 0.13
225 0.13
226 0.16
227 0.18
228 0.18
229 0.16
230 0.16
231 0.2
232 0.2
233 0.22
234 0.23
235 0.24
236 0.23
237 0.24
238 0.22
239 0.18
240 0.17
241 0.15
242 0.16
243 0.19
244 0.26
245 0.3
246 0.33
247 0.33
248 0.36
249 0.41
250 0.41
251 0.45
252 0.46
253 0.45
254 0.45
255 0.52
256 0.55
257 0.56
258 0.58
259 0.54
260 0.46
261 0.44
262 0.42
263 0.36
264 0.31
265 0.28
266 0.24
267 0.22
268 0.21
269 0.2
270 0.22
271 0.21
272 0.21
273 0.22
274 0.24
275 0.24
276 0.3
277 0.33
278 0.34
279 0.34
280 0.36
281 0.37
282 0.36
283 0.36
284 0.37
285 0.36
286 0.34
287 0.36
288 0.35
289 0.31
290 0.28
291 0.25
292 0.18
293 0.14
294 0.1
295 0.08
296 0.07
297 0.06
298 0.05
299 0.05
300 0.07
301 0.08
302 0.09
303 0.1
304 0.15
305 0.21
306 0.27
307 0.33
308 0.4
309 0.5
310 0.58
311 0.68
312 0.71
313 0.75
314 0.8
315 0.82
316 0.81
317 0.75