Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CPP6

Protein Details
Accession X0CPP6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-98KTAASKPKTTKSKTSKPKKVSKPKASKPKASKPKSTTPTHydrophilic
NLS Segment(s)
PositionSequence
64-93SKPKTTKSKTSKPKKVSKPKASKPKASKPK
Subcellular Location(s) extr 13, mito 8.5, cyto_mito 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007112  Expansin/allergen_DPBB_dom  
IPR036749  Expansin_CBD_sf  
IPR036908  RlpA-like_sf  
Gene Ontology GO:0048856  P:anatomical structure development  
PROSITE View protein in PROSITE  
PS50842  EXPANSIN_EG45  
CDD cd22271  DPBB_EXP_N-like  
Amino Acid Sequences MKFFLPILLAAPAVMGRACKVRHSHSSAVEAVHTQYPVPEPVISQAPQVVGQKSSPVEVKTAASKPKTTKSKTSKPKKVSKPKASKPKASKPKSTTPTTTKPSTPKTSTPSTGSSSKSTPLGDGASVSGSSTFYGGNLAGGNCMFSTYTLPSGILGTAFSGQEWDNSANCGACIEVTGPSGTIKAMIVDKCPECDPGHLDLFPDAFKAVGGTDGIVKTSYKFVECGITTPLVLHNKEGTSANWFSIQVVNANEPVKSVQVSTDGGSTWKSTERKDYNFFENPAGFGKTSVDVKVTSSTGKSVVVKNVGVTAGAQYKASSNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.14
5 0.15
6 0.21
7 0.26
8 0.32
9 0.41
10 0.48
11 0.53
12 0.51
13 0.56
14 0.52
15 0.48
16 0.42
17 0.34
18 0.29
19 0.25
20 0.21
21 0.16
22 0.15
23 0.16
24 0.17
25 0.18
26 0.15
27 0.13
28 0.16
29 0.21
30 0.2
31 0.19
32 0.19
33 0.18
34 0.21
35 0.24
36 0.22
37 0.18
38 0.18
39 0.21
40 0.2
41 0.22
42 0.22
43 0.19
44 0.19
45 0.19
46 0.21
47 0.23
48 0.28
49 0.32
50 0.32
51 0.37
52 0.4
53 0.48
54 0.56
55 0.55
56 0.6
57 0.63
58 0.71
59 0.77
60 0.83
61 0.83
62 0.83
63 0.88
64 0.89
65 0.91
66 0.91
67 0.91
68 0.91
69 0.91
70 0.93
71 0.9
72 0.89
73 0.87
74 0.87
75 0.87
76 0.83
77 0.82
78 0.78
79 0.81
80 0.77
81 0.74
82 0.7
83 0.67
84 0.69
85 0.64
86 0.61
87 0.56
88 0.56
89 0.57
90 0.57
91 0.54
92 0.51
93 0.5
94 0.52
95 0.5
96 0.47
97 0.43
98 0.4
99 0.39
100 0.36
101 0.34
102 0.29
103 0.28
104 0.26
105 0.23
106 0.19
107 0.16
108 0.14
109 0.11
110 0.11
111 0.09
112 0.08
113 0.07
114 0.07
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.05
122 0.05
123 0.05
124 0.06
125 0.06
126 0.05
127 0.05
128 0.06
129 0.05
130 0.05
131 0.05
132 0.04
133 0.06
134 0.06
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.06
142 0.05
143 0.04
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.06
150 0.08
151 0.08
152 0.07
153 0.08
154 0.09
155 0.08
156 0.07
157 0.07
158 0.05
159 0.04
160 0.04
161 0.04
162 0.05
163 0.05
164 0.05
165 0.06
166 0.06
167 0.06
168 0.06
169 0.05
170 0.05
171 0.05
172 0.09
173 0.09
174 0.1
175 0.14
176 0.14
177 0.15
178 0.16
179 0.18
180 0.15
181 0.17
182 0.19
183 0.19
184 0.2
185 0.19
186 0.18
187 0.17
188 0.16
189 0.15
190 0.12
191 0.08
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.04
199 0.07
200 0.07
201 0.07
202 0.08
203 0.08
204 0.08
205 0.11
206 0.12
207 0.1
208 0.11
209 0.11
210 0.16
211 0.16
212 0.17
213 0.17
214 0.16
215 0.15
216 0.15
217 0.2
218 0.19
219 0.19
220 0.19
221 0.19
222 0.19
223 0.21
224 0.22
225 0.17
226 0.19
227 0.19
228 0.19
229 0.18
230 0.18
231 0.17
232 0.18
233 0.18
234 0.15
235 0.16
236 0.16
237 0.18
238 0.18
239 0.17
240 0.15
241 0.16
242 0.14
243 0.13
244 0.12
245 0.09
246 0.12
247 0.13
248 0.13
249 0.14
250 0.13
251 0.13
252 0.14
253 0.13
254 0.12
255 0.18
256 0.2
257 0.22
258 0.32
259 0.39
260 0.45
261 0.51
262 0.54
263 0.55
264 0.59
265 0.58
266 0.53
267 0.46
268 0.41
269 0.36
270 0.34
271 0.26
272 0.2
273 0.2
274 0.18
275 0.2
276 0.19
277 0.18
278 0.16
279 0.18
280 0.21
281 0.2
282 0.19
283 0.18
284 0.19
285 0.19
286 0.22
287 0.24
288 0.25
289 0.3
290 0.31
291 0.31
292 0.3
293 0.31
294 0.27
295 0.23
296 0.19
297 0.17
298 0.18
299 0.18
300 0.18
301 0.16