Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0CGI4

Protein Details
Accession X0CGI4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
78-102KPEPHYPPKPQPHYPPKPHKPDYPGBasic
NLS Segment(s)
PositionSequence
67-73PKPHKPE
Subcellular Location(s) mito 11, cyto 7, extr 6, vacu 2
Family & Domain DBs
Amino Acid Sequences MKLSAVTLLALSSGAVSAPVAEPGREVSYHEYKPKPYDPGCGIEKPKPHKPWENYPSQPEKPHYPPPKPHKPEPWYPKPEPHYPPKPQPHYPPKPHKPDYPGKPDYPGPGNPDKPST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.05
5 0.05
6 0.09
7 0.09
8 0.09
9 0.1
10 0.12
11 0.14
12 0.13
13 0.15
14 0.18
15 0.24
16 0.28
17 0.34
18 0.35
19 0.36
20 0.41
21 0.43
22 0.44
23 0.38
24 0.42
25 0.38
26 0.4
27 0.41
28 0.41
29 0.4
30 0.37
31 0.42
32 0.42
33 0.48
34 0.48
35 0.5
36 0.54
37 0.56
38 0.62
39 0.62
40 0.64
41 0.58
42 0.59
43 0.6
44 0.54
45 0.52
46 0.44
47 0.44
48 0.4
49 0.47
50 0.49
51 0.48
52 0.54
53 0.6
54 0.69
55 0.69
56 0.71
57 0.71
58 0.69
59 0.73
60 0.74
61 0.75
62 0.72
63 0.69
64 0.7
65 0.65
66 0.68
67 0.64
68 0.64
69 0.63
70 0.62
71 0.69
72 0.71
73 0.73
74 0.71
75 0.76
76 0.77
77 0.79
78 0.82
79 0.83
80 0.83
81 0.86
82 0.85
83 0.82
84 0.79
85 0.79
86 0.77
87 0.76
88 0.73
89 0.65
90 0.64
91 0.59
92 0.57
93 0.52
94 0.47
95 0.43
96 0.46
97 0.49